Advances in manufacturing technology :: selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China /
The studies presented here cover composites, micro/nano-materials and equipment, metallic alloys, steels, polymer materials, optical/electronic/magnetic materials, energy materials and new energy technology, environmentally-friendly materials and waste utilization, biomaterials and preparation techn...
Saved in:
Corporate Author: | |
---|---|
Other Authors: | |
Format: | Electronic Conference Proceeding eBook |
Language: | English |
Published: |
Durnten-Zurich :
Trans Tech,
2012.
|
Series: | Applied mechanics and materials ;
v. 220-223. |
Subjects: | |
Online Access: | DE-862 DE-863 |
Summary: | The studies presented here cover composites, micro/nano-materials and equipment, metallic alloys, steels, polymer materials, optical/electronic/magnetic materials, energy materials and new energy technology, environmentally-friendly materials and waste utilization, biomaterials and preparation technology, thin films, structural materials and earthquake-resistant structures, functional materials, surface-engineering/coatings, modeling, analysis and simulation, materials processing technology, laser-processing technology, mechanical behavior and fracture, tooling testing and evaluation of materi. |
Physical Description: | 1 online resource (xli, 3105 pages) : illustrations (some color) |
Bibliography: | Includes bibliographical references and index. |
ISBN: | 9783038132356 3038132357 |
ISSN: | 1660-9336 ; |
Staff View
MARC
LEADER | 00000cam a2200000 a 4500 | ||
---|---|---|---|
001 | ZDB-4-EBA-ocn820728912 | ||
003 | OCoLC | ||
005 | 20250103110447.0 | ||
006 | m o d | ||
007 | cr cnu---unuuu | ||
008 | 121210s2012 sz a ob 101 0 eng d | ||
040 | |a CUS |b eng |e pn |c CUS |d N$T |d OCLCO |d YDXCP |d EBLCP |d DEBSZ |d OCLCQ |d AGLDB |d OCLCF |d OCLCQ |d VTS |d STF |d M8D |d OCLCQ |d AJS |d OCLCO |d OCLCQ |d OCLCO |d OCLCQ |d OCLCL | ||
019 | |a 842302040 |a 861213898 |a 897641168 | ||
020 | |a 9783038132356 |q (electronic bk.) | ||
020 | |a 3038132357 |q (electronic bk.) | ||
020 | |z 9783037855034 |q (pbk.) | ||
020 | |z 3037855037 |q (pbk.) | ||
035 | |a (OCoLC)820728912 |z (OCoLC)842302040 |z (OCoLC)861213898 |z (OCoLC)897641168 | ||
050 | 4 | |a TS183 |b .I556 2012 | |
072 | 7 | |a TEC |x 009060 |2 bisacsh | |
082 | 7 | |a 670.4275 |2 22 | |
049 | |a MAIN | ||
111 | 2 | |a International Conference on Advanced Design and Manufacturing Engineering |n (2nd : |d 2012 : |c Taiyuan, Shanxi Sheng, China) | |
245 | 1 | 0 | |a Advances in manufacturing technology : |b selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China / |c edited by Zhengyi Jiang [and others]. |
246 | 3 | 0 | |a 2nd International Conference on Advanced Design and Manufacturing Engineering |
246 | 3 | |a Second International Conference on Advanced Design and Manufacturing Engineering | |
246 | 3 | 0 | |a International Conference on Advanced Design and Manufacturing Engineering |
246 | 3 | 0 | |a ADME 2012 |
260 | |a Durnten-Zurich : |b Trans Tech, |c 2012. | ||
300 | |a 1 online resource (xli, 3105 pages) : |b illustrations (some color) | ||
336 | |a text |b txt |2 rdacontent | ||
337 | |a computer |b c |2 rdamedia | ||
338 | |a online resource |b cr |2 rdacarrier | ||
490 | 1 | |a Applied mechanics and materials, |x 1660-9336 ; |v v. 220-223 | |
504 | |a Includes bibliographical references and index. | ||
588 | 0 | |a Print version record. | |
505 | 0 | |a Advances in Manufacturing Technology; Preface and Conference Organization; Table of Contents; Chapter 1: Bionic Mechanisms, Virtual Manufacturing and Lean Production; Digital Testing Methods of Virtual Prototype and Applied Research Facing to Product; Study on Bionic Principles of the Parasitoid Fly Ormia Ochracea for Sound Source Localization; Human Body and Intelligent Bionic Architecture Design in Electronic Age; Research on Production Cycle Monitoring Strategy Based on Network-Based Manufacturing. | |
505 | 8 | |a Research on KBE System of Intelligent Digital Prototyping Assembly Sequence Planning Based on NXStudy of Lean Production's Impact on Improving Manufacturing Enterprise's Core Competitiveness; Virtual Prototype Construct of Agricultural Tricycle Based on Driver-Tricycle-Road; Study on the Virtual Instrument for Coaxiality Error; Research on the Hybrid Supply Chain of Lean Production and Agile Manufacturing; Studying on the Technique of Integration Analysis to Rigid-Flexible Mixture Virtual Prototyping in Complex Mechanic System. | |
505 | 8 | |a Virtual Manipulation of Eon Studio-Based for High Speed Labeling MachineCloud Machining Community for Social Manufacturing; Chapter 2: Remanufacturing and Digital Manufacturing; Numerical Control Remanufacturing for Relief Grinding Machine; Research of Encoding Rules for RFID Tags Used in Automobile Parts Production Line; The Scheduling Frame Research Facing Rapid Response Manufacturing; Study on Repair Techniques of Loader pin Based on Remanufacturing; Performance Examination about the Remanufacturing Engine Crankshaft Based on the ""Size Recovery." | |
505 | 8 | |a PDF417 Barcode and Digital Anti-Fake Technology in Applications of CigarettesChapter 3: System Analysis and Industrial Engineering; AGC Control of Scheduling with Distributing Power Generation and Performance Study; Comprehensive Evaluation Research on Human-Machine Relationship of CNC Machining Center in Furniture Manufacturing; The Operator Workflow Analysis and Skill Standards Determined for Multi-Variety and Small Batch Processing Post; The Occurrence of Special Components in Blast Furnace Slag of Baotou Iron and Steel Company. | |
505 | 8 | |a Agile Intelligent Research of Manufacturing System in Modern EnterprisesStudy on Facility Layout of a Manufacturing Shop Based on SLP Method; Study of Location Optimization Scheduling with Multiple Storage Tasks at Container Storage Area of Airport Freight Station; Two-Stage Design for Cellular Manufacturing System; Study on Maintenance Period of Reserve System Based on Markov Process; Research on Simulation Data Management of Complicated Mechanical Product; An Analysis on Wellbore Collapse of Open Hole Completion in Carbonate Formation. | |
520 | |a The studies presented here cover composites, micro/nano-materials and equipment, metallic alloys, steels, polymer materials, optical/electronic/magnetic materials, energy materials and new energy technology, environmentally-friendly materials and waste utilization, biomaterials and preparation technology, thin films, structural materials and earthquake-resistant structures, functional materials, surface-engineering/coatings, modeling, analysis and simulation, materials processing technology, laser-processing technology, mechanical behavior and fracture, tooling testing and evaluation of materi. | ||
650 | 0 | |a Production engineering |x Technological innovations |v Congresses. | |
650 | 0 | |a Manufacturing industries |x Technological innovations |v Congresses. | |
650 | 0 | |a Industrial design |x Technological innovations |v Congresses. | |
650 | 0 | |a Materials |x Research |x Technological innovations |v Congresses. | |
650 | 6 | |a Technique de la production |x Innovations |v Congrès. | |
650 | 6 | |a Industrie manufacturière |x Innovations |v Congrès. | |
650 | 6 | |a Design |x Innovations |v Congrès. | |
650 | 6 | |a Matériaux |x Recherche |x Innovations |v Congrès. | |
650 | 7 | |a TECHNOLOGY & ENGINEERING |x Industrial Engineering. |2 bisacsh | |
650 | 7 | |a Manufacturing industries |x Technological innovations |2 fast | |
650 | 7 | |a Production engineering |x Technological innovations |2 fast | |
653 | |a Advanced design |a Manufacturing technology |a Design |a Manufacturing engineering |a ADME | ||
655 | 7 | |a Conference papers and proceedings |2 fast | |
700 | 1 | |a Jiang, Zhengyi. | |
758 | |i has work: |a Advances in manufacturing technology (Text) |1 https://id.oclc.org/worldcat/entity/E39PCGXJJRJqMw4PwqpyrfKwyb |4 https://id.oclc.org/worldcat/ontology/hasWork | ||
776 | 0 | 8 | |i Print version: |a International Conference on Advanced Design and Manufacturing Engineering (2nd : 2012 : Taiyuan, Shanxi Sheng, China). |t Advances in manufacturing technology. |d Durnten-Zurich : Trans Tech, 2012 |w (OCoLC)815362720 |
830 | 0 | |a Applied mechanics and materials ; |v v. 220-223. |0 http://id.loc.gov/authorities/names/no2009039852 | |
966 | 4 | 0 | |l DE-862 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517414 |3 Volltext |
966 | 4 | 0 | |l DE-863 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517414 |3 Volltext |
938 | |a ProQuest Ebook Central |b EBLB |n EBL1872957 | ||
938 | |a EBSCOhost |b EBSC |n 517414 | ||
938 | |a YBP Library Services |b YANK |n 9965877 | ||
994 | |a 92 |b GEBAY | ||
912 | |a ZDB-4-EBA | ||
049 | |a DE-862 | ||
049 | |a DE-863 |
Record in the Search Index
DE-BY-FWS_katkey | ZDB-4-EBA-ocn820728912 |
---|---|
_version_ | 1829094943433424896 |
adam_text | |
any_adam_object | |
author2 | Jiang, Zhengyi |
author2_role | |
author2_variant | z j zj |
author_corporate | International Conference on Advanced Design and Manufacturing Engineering Taiyuan, Shanxi Sheng, China |
author_corporate_role | |
author_facet | Jiang, Zhengyi International Conference on Advanced Design and Manufacturing Engineering Taiyuan, Shanxi Sheng, China |
author_sort | International Conference on Advanced Design and Manufacturing Engineering Taiyuan, Shanxi Sheng, China |
building | Verbundindex |
bvnumber | localFWS |
callnumber-first | T - Technology |
callnumber-label | TS183 |
callnumber-raw | TS183 .I556 2012 |
callnumber-search | TS183 .I556 2012 |
callnumber-sort | TS 3183 I556 42012 |
callnumber-subject | TS - Manufactures |
collection | ZDB-4-EBA |
contents | Advances in Manufacturing Technology; Preface and Conference Organization; Table of Contents; Chapter 1: Bionic Mechanisms, Virtual Manufacturing and Lean Production; Digital Testing Methods of Virtual Prototype and Applied Research Facing to Product; Study on Bionic Principles of the Parasitoid Fly Ormia Ochracea for Sound Source Localization; Human Body and Intelligent Bionic Architecture Design in Electronic Age; Research on Production Cycle Monitoring Strategy Based on Network-Based Manufacturing. Research on KBE System of Intelligent Digital Prototyping Assembly Sequence Planning Based on NXStudy of Lean Production's Impact on Improving Manufacturing Enterprise's Core Competitiveness; Virtual Prototype Construct of Agricultural Tricycle Based on Driver-Tricycle-Road; Study on the Virtual Instrument for Coaxiality Error; Research on the Hybrid Supply Chain of Lean Production and Agile Manufacturing; Studying on the Technique of Integration Analysis to Rigid-Flexible Mixture Virtual Prototyping in Complex Mechanic System. Virtual Manipulation of Eon Studio-Based for High Speed Labeling MachineCloud Machining Community for Social Manufacturing; Chapter 2: Remanufacturing and Digital Manufacturing; Numerical Control Remanufacturing for Relief Grinding Machine; Research of Encoding Rules for RFID Tags Used in Automobile Parts Production Line; The Scheduling Frame Research Facing Rapid Response Manufacturing; Study on Repair Techniques of Loader pin Based on Remanufacturing; Performance Examination about the Remanufacturing Engine Crankshaft Based on the ""Size Recovery." PDF417 Barcode and Digital Anti-Fake Technology in Applications of CigarettesChapter 3: System Analysis and Industrial Engineering; AGC Control of Scheduling with Distributing Power Generation and Performance Study; Comprehensive Evaluation Research on Human-Machine Relationship of CNC Machining Center in Furniture Manufacturing; The Operator Workflow Analysis and Skill Standards Determined for Multi-Variety and Small Batch Processing Post; The Occurrence of Special Components in Blast Furnace Slag of Baotou Iron and Steel Company. Agile Intelligent Research of Manufacturing System in Modern EnterprisesStudy on Facility Layout of a Manufacturing Shop Based on SLP Method; Study of Location Optimization Scheduling with Multiple Storage Tasks at Container Storage Area of Airport Freight Station; Two-Stage Design for Cellular Manufacturing System; Study on Maintenance Period of Reserve System Based on Markov Process; Research on Simulation Data Management of Complicated Mechanical Product; An Analysis on Wellbore Collapse of Open Hole Completion in Carbonate Formation. |
ctrlnum | (OCoLC)820728912 |
dewey-full | 670.4275 |
dewey-hundreds | 600 - Technology (Applied sciences) |
dewey-ones | 670 - Manufacturing |
dewey-raw | 670.4275 |
dewey-search | 670.4275 |
dewey-sort | 3670.4275 |
dewey-tens | 670 - Manufacturing |
discipline | Werkstoffwissenschaften / Fertigungstechnik |
format | Electronic Conference Proceeding eBook |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>07085cam a2200733 a 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn820728912</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20250103110447.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cnu---unuuu</controlfield><controlfield tag="008">121210s2012 sz a ob 101 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">CUS</subfield><subfield code="b">eng</subfield><subfield code="e">pn</subfield><subfield code="c">CUS</subfield><subfield code="d">N$T</subfield><subfield code="d">OCLCO</subfield><subfield code="d">YDXCP</subfield><subfield code="d">EBLCP</subfield><subfield code="d">DEBSZ</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">AGLDB</subfield><subfield code="d">OCLCF</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VTS</subfield><subfield code="d">STF</subfield><subfield code="d">M8D</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">AJS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCL</subfield></datafield><datafield tag="019" ind1=" " ind2=" "><subfield code="a">842302040</subfield><subfield code="a">861213898</subfield><subfield code="a">897641168</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038132356</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038132357</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9783037855034</subfield><subfield code="q">(pbk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">3037855037</subfield><subfield code="q">(pbk.)</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)820728912</subfield><subfield code="z">(OCoLC)842302040</subfield><subfield code="z">(OCoLC)861213898</subfield><subfield code="z">(OCoLC)897641168</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">TS183</subfield><subfield code="b">.I556 2012</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">009060</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">670.4275</subfield><subfield code="2">22</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Conference on Advanced Design and Manufacturing Engineering</subfield><subfield code="n">(2nd :</subfield><subfield code="d">2012 :</subfield><subfield code="c">Taiyuan, Shanxi Sheng, China)</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Advances in manufacturing technology :</subfield><subfield code="b">selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China /</subfield><subfield code="c">edited by Zhengyi Jiang [and others].</subfield></datafield><datafield tag="246" ind1="3" ind2="0"><subfield code="a">2nd International Conference on Advanced Design and Manufacturing Engineering</subfield></datafield><datafield tag="246" ind1="3" ind2=" "><subfield code="a">Second International Conference on Advanced Design and Manufacturing Engineering</subfield></datafield><datafield tag="246" ind1="3" ind2="0"><subfield code="a">International Conference on Advanced Design and Manufacturing Engineering</subfield></datafield><datafield tag="246" ind1="3" ind2="0"><subfield code="a">ADME 2012</subfield></datafield><datafield tag="260" ind1=" " ind2=" "><subfield code="a">Durnten-Zurich :</subfield><subfield code="b">Trans Tech,</subfield><subfield code="c">2012.</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (xli, 3105 pages) :</subfield><subfield code="b">illustrations (some color)</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Applied mechanics and materials,</subfield><subfield code="x">1660-9336 ;</subfield><subfield code="v">v. 220-223</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and index.</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Print version record.</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Advances in Manufacturing Technology; Preface and Conference Organization; Table of Contents; Chapter 1: Bionic Mechanisms, Virtual Manufacturing and Lean Production; Digital Testing Methods of Virtual Prototype and Applied Research Facing to Product; Study on Bionic Principles of the Parasitoid Fly Ormia Ochracea for Sound Source Localization; Human Body and Intelligent Bionic Architecture Design in Electronic Age; Research on Production Cycle Monitoring Strategy Based on Network-Based Manufacturing.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Research on KBE System of Intelligent Digital Prototyping Assembly Sequence Planning Based on NXStudy of Lean Production's Impact on Improving Manufacturing Enterprise's Core Competitiveness; Virtual Prototype Construct of Agricultural Tricycle Based on Driver-Tricycle-Road; Study on the Virtual Instrument for Coaxiality Error; Research on the Hybrid Supply Chain of Lean Production and Agile Manufacturing; Studying on the Technique of Integration Analysis to Rigid-Flexible Mixture Virtual Prototyping in Complex Mechanic System.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Virtual Manipulation of Eon Studio-Based for High Speed Labeling MachineCloud Machining Community for Social Manufacturing; Chapter 2: Remanufacturing and Digital Manufacturing; Numerical Control Remanufacturing for Relief Grinding Machine; Research of Encoding Rules for RFID Tags Used in Automobile Parts Production Line; The Scheduling Frame Research Facing Rapid Response Manufacturing; Study on Repair Techniques of Loader pin Based on Remanufacturing; Performance Examination about the Remanufacturing Engine Crankshaft Based on the ""Size Recovery."</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">PDF417 Barcode and Digital Anti-Fake Technology in Applications of CigarettesChapter 3: System Analysis and Industrial Engineering; AGC Control of Scheduling with Distributing Power Generation and Performance Study; Comprehensive Evaluation Research on Human-Machine Relationship of CNC Machining Center in Furniture Manufacturing; The Operator Workflow Analysis and Skill Standards Determined for Multi-Variety and Small Batch Processing Post; The Occurrence of Special Components in Blast Furnace Slag of Baotou Iron and Steel Company.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Agile Intelligent Research of Manufacturing System in Modern EnterprisesStudy on Facility Layout of a Manufacturing Shop Based on SLP Method; Study of Location Optimization Scheduling with Multiple Storage Tasks at Container Storage Area of Airport Freight Station; Two-Stage Design for Cellular Manufacturing System; Study on Maintenance Period of Reserve System Based on Markov Process; Research on Simulation Data Management of Complicated Mechanical Product; An Analysis on Wellbore Collapse of Open Hole Completion in Carbonate Formation.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">The studies presented here cover composites, micro/nano-materials and equipment, metallic alloys, steels, polymer materials, optical/electronic/magnetic materials, energy materials and new energy technology, environmentally-friendly materials and waste utilization, biomaterials and preparation technology, thin films, structural materials and earthquake-resistant structures, functional materials, surface-engineering/coatings, modeling, analysis and simulation, materials processing technology, laser-processing technology, mechanical behavior and fracture, tooling testing and evaluation of materi.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Production engineering</subfield><subfield code="x">Technological innovations</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Manufacturing industries</subfield><subfield code="x">Technological innovations</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Industrial design</subfield><subfield code="x">Technological innovations</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Materials</subfield><subfield code="x">Research</subfield><subfield code="x">Technological innovations</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Technique de la production</subfield><subfield code="x">Innovations</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Industrie manufacturière</subfield><subfield code="x">Innovations</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Design</subfield><subfield code="x">Innovations</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Matériaux</subfield><subfield code="x">Recherche</subfield><subfield code="x">Innovations</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Industrial Engineering.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Manufacturing industries</subfield><subfield code="x">Technological innovations</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Production engineering</subfield><subfield code="x">Technological innovations</subfield><subfield code="2">fast</subfield></datafield><datafield tag="653" ind1=" " ind2=" "><subfield code="a">Advanced design</subfield><subfield code="a">Manufacturing technology</subfield><subfield code="a">Design</subfield><subfield code="a">Manufacturing engineering</subfield><subfield code="a">ADME</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Jiang, Zhengyi.</subfield></datafield><datafield tag="758" ind1=" " ind2=" "><subfield code="i">has work:</subfield><subfield code="a">Advances in manufacturing technology (Text)</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PCGXJJRJqMw4PwqpyrfKwyb</subfield><subfield code="4">https://id.oclc.org/worldcat/ontology/hasWork</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="a">International Conference on Advanced Design and Manufacturing Engineering (2nd : 2012 : Taiyuan, Shanxi Sheng, China).</subfield><subfield code="t">Advances in manufacturing technology.</subfield><subfield code="d">Durnten-Zurich : Trans Tech, 2012</subfield><subfield code="w">(OCoLC)815362720</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Applied mechanics and materials ;</subfield><subfield code="v">v. 220-223.</subfield><subfield code="0">http://id.loc.gov/authorities/names/no2009039852</subfield></datafield><datafield tag="966" ind1="4" ind2="0"><subfield code="l">DE-862</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517414</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="4" ind2="0"><subfield code="l">DE-863</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517414</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ProQuest Ebook Central</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL1872957</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">517414</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">9965877</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-862</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-863</subfield></datafield></record></collection> |
genre | Conference papers and proceedings fast |
genre_facet | Conference papers and proceedings |
id | ZDB-4-EBA-ocn820728912 |
illustrated | Illustrated |
indexdate | 2025-04-11T08:41:09Z |
institution | BVB |
isbn | 9783038132356 3038132357 |
issn | 1660-9336 ; |
language | English |
oclc_num | 820728912 |
open_access_boolean | |
owner | MAIN DE-862 DE-BY-FWS DE-863 DE-BY-FWS |
owner_facet | MAIN DE-862 DE-BY-FWS DE-863 DE-BY-FWS |
physical | 1 online resource (xli, 3105 pages) : illustrations (some color) |
psigel | ZDB-4-EBA FWS_PDA_EBA ZDB-4-EBA |
publishDate | 2012 |
publishDateSearch | 2012 |
publishDateSort | 2012 |
publisher | Trans Tech, |
record_format | marc |
series | Applied mechanics and materials ; |
series2 | Applied mechanics and materials, |
spelling | International Conference on Advanced Design and Manufacturing Engineering (2nd : 2012 : Taiyuan, Shanxi Sheng, China) Advances in manufacturing technology : selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China / edited by Zhengyi Jiang [and others]. 2nd International Conference on Advanced Design and Manufacturing Engineering Second International Conference on Advanced Design and Manufacturing Engineering International Conference on Advanced Design and Manufacturing Engineering ADME 2012 Durnten-Zurich : Trans Tech, 2012. 1 online resource (xli, 3105 pages) : illustrations (some color) text txt rdacontent computer c rdamedia online resource cr rdacarrier Applied mechanics and materials, 1660-9336 ; v. 220-223 Includes bibliographical references and index. Print version record. Advances in Manufacturing Technology; Preface and Conference Organization; Table of Contents; Chapter 1: Bionic Mechanisms, Virtual Manufacturing and Lean Production; Digital Testing Methods of Virtual Prototype and Applied Research Facing to Product; Study on Bionic Principles of the Parasitoid Fly Ormia Ochracea for Sound Source Localization; Human Body and Intelligent Bionic Architecture Design in Electronic Age; Research on Production Cycle Monitoring Strategy Based on Network-Based Manufacturing. Research on KBE System of Intelligent Digital Prototyping Assembly Sequence Planning Based on NXStudy of Lean Production's Impact on Improving Manufacturing Enterprise's Core Competitiveness; Virtual Prototype Construct of Agricultural Tricycle Based on Driver-Tricycle-Road; Study on the Virtual Instrument for Coaxiality Error; Research on the Hybrid Supply Chain of Lean Production and Agile Manufacturing; Studying on the Technique of Integration Analysis to Rigid-Flexible Mixture Virtual Prototyping in Complex Mechanic System. Virtual Manipulation of Eon Studio-Based for High Speed Labeling MachineCloud Machining Community for Social Manufacturing; Chapter 2: Remanufacturing and Digital Manufacturing; Numerical Control Remanufacturing for Relief Grinding Machine; Research of Encoding Rules for RFID Tags Used in Automobile Parts Production Line; The Scheduling Frame Research Facing Rapid Response Manufacturing; Study on Repair Techniques of Loader pin Based on Remanufacturing; Performance Examination about the Remanufacturing Engine Crankshaft Based on the ""Size Recovery." PDF417 Barcode and Digital Anti-Fake Technology in Applications of CigarettesChapter 3: System Analysis and Industrial Engineering; AGC Control of Scheduling with Distributing Power Generation and Performance Study; Comprehensive Evaluation Research on Human-Machine Relationship of CNC Machining Center in Furniture Manufacturing; The Operator Workflow Analysis and Skill Standards Determined for Multi-Variety and Small Batch Processing Post; The Occurrence of Special Components in Blast Furnace Slag of Baotou Iron and Steel Company. Agile Intelligent Research of Manufacturing System in Modern EnterprisesStudy on Facility Layout of a Manufacturing Shop Based on SLP Method; Study of Location Optimization Scheduling with Multiple Storage Tasks at Container Storage Area of Airport Freight Station; Two-Stage Design for Cellular Manufacturing System; Study on Maintenance Period of Reserve System Based on Markov Process; Research on Simulation Data Management of Complicated Mechanical Product; An Analysis on Wellbore Collapse of Open Hole Completion in Carbonate Formation. The studies presented here cover composites, micro/nano-materials and equipment, metallic alloys, steels, polymer materials, optical/electronic/magnetic materials, energy materials and new energy technology, environmentally-friendly materials and waste utilization, biomaterials and preparation technology, thin films, structural materials and earthquake-resistant structures, functional materials, surface-engineering/coatings, modeling, analysis and simulation, materials processing technology, laser-processing technology, mechanical behavior and fracture, tooling testing and evaluation of materi. Production engineering Technological innovations Congresses. Manufacturing industries Technological innovations Congresses. Industrial design Technological innovations Congresses. Materials Research Technological innovations Congresses. Technique de la production Innovations Congrès. Industrie manufacturière Innovations Congrès. Design Innovations Congrès. Matériaux Recherche Innovations Congrès. TECHNOLOGY & ENGINEERING Industrial Engineering. bisacsh Manufacturing industries Technological innovations fast Production engineering Technological innovations fast Advanced design Manufacturing technology Design Manufacturing engineering ADME Conference papers and proceedings fast Jiang, Zhengyi. has work: Advances in manufacturing technology (Text) https://id.oclc.org/worldcat/entity/E39PCGXJJRJqMw4PwqpyrfKwyb https://id.oclc.org/worldcat/ontology/hasWork Print version: International Conference on Advanced Design and Manufacturing Engineering (2nd : 2012 : Taiyuan, Shanxi Sheng, China). Advances in manufacturing technology. Durnten-Zurich : Trans Tech, 2012 (OCoLC)815362720 Applied mechanics and materials ; v. 220-223. http://id.loc.gov/authorities/names/no2009039852 |
spellingShingle | Advances in manufacturing technology : selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China / Applied mechanics and materials ; Advances in Manufacturing Technology; Preface and Conference Organization; Table of Contents; Chapter 1: Bionic Mechanisms, Virtual Manufacturing and Lean Production; Digital Testing Methods of Virtual Prototype and Applied Research Facing to Product; Study on Bionic Principles of the Parasitoid Fly Ormia Ochracea for Sound Source Localization; Human Body and Intelligent Bionic Architecture Design in Electronic Age; Research on Production Cycle Monitoring Strategy Based on Network-Based Manufacturing. Research on KBE System of Intelligent Digital Prototyping Assembly Sequence Planning Based on NXStudy of Lean Production's Impact on Improving Manufacturing Enterprise's Core Competitiveness; Virtual Prototype Construct of Agricultural Tricycle Based on Driver-Tricycle-Road; Study on the Virtual Instrument for Coaxiality Error; Research on the Hybrid Supply Chain of Lean Production and Agile Manufacturing; Studying on the Technique of Integration Analysis to Rigid-Flexible Mixture Virtual Prototyping in Complex Mechanic System. Virtual Manipulation of Eon Studio-Based for High Speed Labeling MachineCloud Machining Community for Social Manufacturing; Chapter 2: Remanufacturing and Digital Manufacturing; Numerical Control Remanufacturing for Relief Grinding Machine; Research of Encoding Rules for RFID Tags Used in Automobile Parts Production Line; The Scheduling Frame Research Facing Rapid Response Manufacturing; Study on Repair Techniques of Loader pin Based on Remanufacturing; Performance Examination about the Remanufacturing Engine Crankshaft Based on the ""Size Recovery." PDF417 Barcode and Digital Anti-Fake Technology in Applications of CigarettesChapter 3: System Analysis and Industrial Engineering; AGC Control of Scheduling with Distributing Power Generation and Performance Study; Comprehensive Evaluation Research on Human-Machine Relationship of CNC Machining Center in Furniture Manufacturing; The Operator Workflow Analysis and Skill Standards Determined for Multi-Variety and Small Batch Processing Post; The Occurrence of Special Components in Blast Furnace Slag of Baotou Iron and Steel Company. Agile Intelligent Research of Manufacturing System in Modern EnterprisesStudy on Facility Layout of a Manufacturing Shop Based on SLP Method; Study of Location Optimization Scheduling with Multiple Storage Tasks at Container Storage Area of Airport Freight Station; Two-Stage Design for Cellular Manufacturing System; Study on Maintenance Period of Reserve System Based on Markov Process; Research on Simulation Data Management of Complicated Mechanical Product; An Analysis on Wellbore Collapse of Open Hole Completion in Carbonate Formation. Production engineering Technological innovations Congresses. Manufacturing industries Technological innovations Congresses. Industrial design Technological innovations Congresses. Materials Research Technological innovations Congresses. Technique de la production Innovations Congrès. Industrie manufacturière Innovations Congrès. Design Innovations Congrès. Matériaux Recherche Innovations Congrès. TECHNOLOGY & ENGINEERING Industrial Engineering. bisacsh Manufacturing industries Technological innovations fast Production engineering Technological innovations fast |
title | Advances in manufacturing technology : selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China / |
title_alt | 2nd International Conference on Advanced Design and Manufacturing Engineering Second International Conference on Advanced Design and Manufacturing Engineering International Conference on Advanced Design and Manufacturing Engineering ADME 2012 |
title_auth | Advances in manufacturing technology : selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China / |
title_exact_search | Advances in manufacturing technology : selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China / |
title_full | Advances in manufacturing technology : selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China / edited by Zhengyi Jiang [and others]. |
title_fullStr | Advances in manufacturing technology : selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China / edited by Zhengyi Jiang [and others]. |
title_full_unstemmed | Advances in manufacturing technology : selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China / edited by Zhengyi Jiang [and others]. |
title_short | Advances in manufacturing technology : |
title_sort | advances in manufacturing technology selected peer reviewed papers from the 2nd international conference on advanced design and manufacturing engineering adme 2012 august 16 18 2012 taiyuan china |
title_sub | selected, peer reviewed papers from the 2nd International Conference on Advanced Design and Manufacturing Engineering (ADME 2012), August, 16-18, 2012, Taiyuan, China / |
topic | Production engineering Technological innovations Congresses. Manufacturing industries Technological innovations Congresses. Industrial design Technological innovations Congresses. Materials Research Technological innovations Congresses. Technique de la production Innovations Congrès. Industrie manufacturière Innovations Congrès. Design Innovations Congrès. Matériaux Recherche Innovations Congrès. TECHNOLOGY & ENGINEERING Industrial Engineering. bisacsh Manufacturing industries Technological innovations fast Production engineering Technological innovations fast |
topic_facet | Production engineering Technological innovations Congresses. Manufacturing industries Technological innovations Congresses. Industrial design Technological innovations Congresses. Materials Research Technological innovations Congresses. Technique de la production Innovations Congrès. Industrie manufacturière Innovations Congrès. Design Innovations Congrès. Matériaux Recherche Innovations Congrès. TECHNOLOGY & ENGINEERING Industrial Engineering. Manufacturing industries Technological innovations Production engineering Technological innovations Conference papers and proceedings |
work_keys_str_mv | AT internationalconferenceonadvanceddesignandmanufacturingengineeringtaiyuanshanxishengchina advancesinmanufacturingtechnologyselectedpeerreviewedpapersfromthe2ndinternationalconferenceonadvanceddesignandmanufacturingengineeringadme2012august16182012taiyuanchina AT jiangzhengyi advancesinmanufacturingtechnologyselectedpeerreviewedpapersfromthe2ndinternationalconferenceonadvanceddesignandmanufacturingengineeringadme2012august16182012taiyuanchina AT internationalconferenceonadvanceddesignandmanufacturingengineeringtaiyuanshanxishengchina 2ndinternationalconferenceonadvanceddesignandmanufacturingengineering AT jiangzhengyi 2ndinternationalconferenceonadvanceddesignandmanufacturingengineering AT internationalconferenceonadvanceddesignandmanufacturingengineeringtaiyuanshanxishengchina secondinternationalconferenceonadvanceddesignandmanufacturingengineering AT jiangzhengyi secondinternationalconferenceonadvanceddesignandmanufacturingengineering AT internationalconferenceonadvanceddesignandmanufacturingengineeringtaiyuanshanxishengchina internationalconferenceonadvanceddesignandmanufacturingengineering AT jiangzhengyi internationalconferenceonadvanceddesignandmanufacturingengineering AT internationalconferenceonadvanceddesignandmanufacturingengineeringtaiyuanshanxishengchina adme2012 AT jiangzhengyi adme2012 |