Heterogeneous catalysis and fine chemicals IV: proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996
After three meetings in Poitiers, France, the <IT> 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals</IT> was held under the auspices of the New Swiss Chemical Society in Basel, Switzerland. Fundamental as well as applied contributions on the use of heterogeneous...
Gespeichert in:
Körperschaft: | |
---|---|
Format: | Elektronisch E-Book |
Sprache: | English |
Veröffentlicht: |
Amsterdam New York
Elsevier
1997
|
Schriftenreihe: | Studies in surface science and catalysis
108 |
Schlagworte: | |
Online-Zugang: | FLA01 URL des Erstveröffentlichers URL des Erstveröffentlichers |
Zusammenfassung: | After three meetings in Poitiers, France, the <IT> 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals</IT> was held under the auspices of the New Swiss Chemical Society in Basel, Switzerland. Fundamental as well as applied contributions on the use of heterogeneous catalysis for the preparation of fine chemicals were presented and discussed. The program consisted of 4 plenary lectures, 28 oral contributions and around 90 posters covering a broad range of reactions and catalytic aspects. 82 of these contributions are collected in the present proceedings, grouped into the following 8 topical areas: - Industrial and engineering problems (7 contributions) - Alkylation and acylation reactions (11 contributions) - Enantio- and diastereoselective hydrogenation reactions (9 contributions) - Chemoselective hydrogenation reactions (12 contributions) - Oxidation reactions (14 contributions) - Immobilized and encapsulated complex catalysts (12 contributions) - Zeolite and clay catalysts (12 contributions) - Miscellaneous topics (5 contributions) |
Beschreibung: | Includes bibliographical references and index |
Beschreibung: | 1 online resource (xvi, 675 pages) illustrations |
ISBN: | 9780444823908 0444823905 9780080533933 0080533930 |
Internformat
MARC
LEADER | 00000nmm a2200000zcb4500 | ||
---|---|---|---|
001 | BV046123528 | ||
003 | DE-604 | ||
005 | 00000000000000.0 | ||
006 | a |||| 10||| | ||
007 | cr|uuu---uuuuu | ||
008 | 190827s1997 |||| o||u| ||||||eng d | ||
020 | |a 9780444823908 |9 978-0-444-82390-8 | ||
020 | |a 0444823905 |9 0-444-82390-5 | ||
020 | |a 9780080533933 |9 978-0-08-053393-3 | ||
020 | |a 0080533930 |9 0-08-053393-0 | ||
035 | |a (ZDB-33-ESD)ocn162130792 | ||
035 | |a (OCoLC)162130792 | ||
035 | |a (DE-599)BVBBV046123528 | ||
040 | |a DE-604 |b ger |e rda | ||
041 | 0 | |a eng | |
082 | 0 | |a 541.3/95 |2 22 | |
110 | 2 | |a International Symposium on Heterogeneous Catalysis and Fine Chemicals < 1996, Basel, Switzerland> |e Verfasser |4 aut | |
245 | 1 | 0 | |a Heterogeneous catalysis and fine chemicals IV |b proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996 |c editors, H.U. Blaser, A. Baiker, R. Prins |
264 | 1 | |a Amsterdam |a New York |b Elsevier |c 1997 | |
300 | |a 1 online resource (xvi, 675 pages) |b illustrations | ||
336 | |b txt |2 rdacontent | ||
337 | |b c |2 rdamedia | ||
338 | |b cr |2 rdacarrier | ||
490 | 0 | |a Studies in surface science and catalysis |v 108 | |
500 | |a Includes bibliographical references and index | ||
520 | |a After three meetings in Poitiers, France, the <IT> 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals</IT> was held under the auspices of the New Swiss Chemical Society in Basel, Switzerland. Fundamental as well as applied contributions on the use of heterogeneous catalysis for the preparation of fine chemicals were presented and discussed. The program consisted of 4 plenary lectures, 28 oral contributions and around 90 posters covering a broad range of reactions and catalytic aspects. 82 of these contributions are collected in the present proceedings, grouped into the following 8 topical areas: - Industrial and engineering problems (7 contributions) - Alkylation and acylation reactions (11 contributions) - Enantio- and diastereoselective hydrogenation reactions (9 contributions) - Chemoselective hydrogenation reactions (12 contributions) - Oxidation reactions (14 contributions) - Immobilized and encapsulated complex catalysts (12 contributions) - Zeolite and clay catalysts (12 contributions) - Miscellaneous topics (5 contributions) | ||
650 | 7 | |a SCIENCE / Chemistry / Physical & Theoretical |2 bisacsh | |
650 | 7 | |a Heterogeneous catalysis |2 fast | |
650 | 4 | |a Heterogeneous catalysis |v Congresses | |
655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |2 gnd-content | |
700 | 1 | |a Blaser, H. U. |e Sonstige |4 oth | |
700 | 1 | |a Baiker, A. |e Sonstige |4 oth | |
700 | 1 | |a Prins, Roelof |e Sonstige |4 oth | |
856 | 4 | 0 | |u http://www.sciencedirect.com/science/book/9780444823908 |x Verlag |z URL des Erstveröffentlichers |3 Volltext |
856 | 4 | 0 | |u http://www.sciencedirect.com/science/bookseries/01672991/108 |x Verlag |z URL des Erstveröffentlichers |3 Volltext |
912 | |a ZDB-33-ESD | ||
999 | |a oai:aleph.bib-bvb.de:BVB01-031503981 | ||
966 | e | |u http://www.sciencedirect.com/science/book/9780444823908 |l FLA01 |p ZDB-33-ESD |q FLA_PDA_ESD |x Verlag |3 Volltext |
Datensatz im Suchindex
_version_ | 1804180440543657984 |
---|---|
any_adam_object | |
author_corporate | International Symposium on Heterogeneous Catalysis and Fine Chemicals < 1996, Basel, Switzerland> |
author_corporate_role | aut |
author_facet | International Symposium on Heterogeneous Catalysis and Fine Chemicals < 1996, Basel, Switzerland> |
author_sort | International Symposium on Heterogeneous Catalysis and Fine Chemicals < 1996, Basel, Switzerland> |
building | Verbundindex |
bvnumber | BV046123528 |
collection | ZDB-33-ESD |
ctrlnum | (ZDB-33-ESD)ocn162130792 (OCoLC)162130792 (DE-599)BVBBV046123528 |
dewey-full | 541.3/95 |
dewey-hundreds | 500 - Natural sciences and mathematics |
dewey-ones | 541 - Physical chemistry |
dewey-raw | 541.3/95 |
dewey-search | 541.3/95 |
dewey-sort | 3541.3 295 |
dewey-tens | 540 - Chemistry and allied sciences |
discipline | Chemie / Pharmazie |
format | Electronic eBook |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03193nmm a2200481zcb4500</leader><controlfield tag="001">BV046123528</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">00000000000000.0</controlfield><controlfield tag="006">a |||| 10||| </controlfield><controlfield tag="007">cr|uuu---uuuuu</controlfield><controlfield tag="008">190827s1997 |||| o||u| ||||||eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780444823908</subfield><subfield code="9">978-0-444-82390-8</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0444823905</subfield><subfield code="9">0-444-82390-5</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9780080533933</subfield><subfield code="9">978-0-08-053393-3</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0080533930</subfield><subfield code="9">0-08-053393-0</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ZDB-33-ESD)ocn162130792</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)162130792</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV046123528</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">541.3/95</subfield><subfield code="2">22</subfield></datafield><datafield tag="110" ind1="2" ind2=" "><subfield code="a">International Symposium on Heterogeneous Catalysis and Fine Chemicals < 1996, Basel, Switzerland></subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Heterogeneous catalysis and fine chemicals IV</subfield><subfield code="b">proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996</subfield><subfield code="c">editors, H.U. Blaser, A. Baiker, R. Prins</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Amsterdam</subfield><subfield code="a">New York</subfield><subfield code="b">Elsevier</subfield><subfield code="c">1997</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (xvi, 675 pages)</subfield><subfield code="b">illustrations</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Studies in surface science and catalysis</subfield><subfield code="v">108</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and index</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">After three meetings in Poitiers, France, the <IT> 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals</IT> was held under the auspices of the New Swiss Chemical Society in Basel, Switzerland. Fundamental as well as applied contributions on the use of heterogeneous catalysis for the preparation of fine chemicals were presented and discussed. The program consisted of 4 plenary lectures, 28 oral contributions and around 90 posters covering a broad range of reactions and catalytic aspects. 82 of these contributions are collected in the present proceedings, grouped into the following 8 topical areas: - Industrial and engineering problems (7 contributions) - Alkylation and acylation reactions (11 contributions) - Enantio- and diastereoselective hydrogenation reactions (9 contributions) - Chemoselective hydrogenation reactions (12 contributions) - Oxidation reactions (14 contributions) - Immobilized and encapsulated complex catalysts (12 contributions) - Zeolite and clay catalysts (12 contributions) - Miscellaneous topics (5 contributions)</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">SCIENCE / Chemistry / Physical & Theoretical</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Heterogeneous catalysis</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Heterogeneous catalysis</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Blaser, H. U.</subfield><subfield code="e">Sonstige</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Baiker, A.</subfield><subfield code="e">Sonstige</subfield><subfield code="4">oth</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Prins, Roelof</subfield><subfield code="e">Sonstige</subfield><subfield code="4">oth</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">http://www.sciencedirect.com/science/book/9780444823908</subfield><subfield code="x">Verlag</subfield><subfield code="z">URL des Erstveröffentlichers</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">http://www.sciencedirect.com/science/bookseries/01672991/108</subfield><subfield code="x">Verlag</subfield><subfield code="z">URL des Erstveröffentlichers</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-33-ESD</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-031503981</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://www.sciencedirect.com/science/book/9780444823908</subfield><subfield code="l">FLA01</subfield><subfield code="p">ZDB-33-ESD</subfield><subfield code="q">FLA_PDA_ESD</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield></record></collection> |
genre | (DE-588)1071861417 Konferenzschrift gnd-content |
genre_facet | Konferenzschrift |
id | DE-604.BV046123528 |
illustrated | Illustrated |
indexdate | 2024-07-10T08:35:48Z |
institution | BVB |
isbn | 9780444823908 0444823905 9780080533933 0080533930 |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-031503981 |
oclc_num | 162130792 |
open_access_boolean | |
physical | 1 online resource (xvi, 675 pages) illustrations |
psigel | ZDB-33-ESD ZDB-33-ESD FLA_PDA_ESD |
publishDate | 1997 |
publishDateSearch | 1997 |
publishDateSort | 1997 |
publisher | Elsevier |
record_format | marc |
series2 | Studies in surface science and catalysis |
spelling | International Symposium on Heterogeneous Catalysis and Fine Chemicals < 1996, Basel, Switzerland> Verfasser aut Heterogeneous catalysis and fine chemicals IV proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996 editors, H.U. Blaser, A. Baiker, R. Prins Amsterdam New York Elsevier 1997 1 online resource (xvi, 675 pages) illustrations txt rdacontent c rdamedia cr rdacarrier Studies in surface science and catalysis 108 Includes bibliographical references and index After three meetings in Poitiers, France, the <IT> 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals</IT> was held under the auspices of the New Swiss Chemical Society in Basel, Switzerland. Fundamental as well as applied contributions on the use of heterogeneous catalysis for the preparation of fine chemicals were presented and discussed. The program consisted of 4 plenary lectures, 28 oral contributions and around 90 posters covering a broad range of reactions and catalytic aspects. 82 of these contributions are collected in the present proceedings, grouped into the following 8 topical areas: - Industrial and engineering problems (7 contributions) - Alkylation and acylation reactions (11 contributions) - Enantio- and diastereoselective hydrogenation reactions (9 contributions) - Chemoselective hydrogenation reactions (12 contributions) - Oxidation reactions (14 contributions) - Immobilized and encapsulated complex catalysts (12 contributions) - Zeolite and clay catalysts (12 contributions) - Miscellaneous topics (5 contributions) SCIENCE / Chemistry / Physical & Theoretical bisacsh Heterogeneous catalysis fast Heterogeneous catalysis Congresses (DE-588)1071861417 Konferenzschrift gnd-content Blaser, H. U. Sonstige oth Baiker, A. Sonstige oth Prins, Roelof Sonstige oth http://www.sciencedirect.com/science/book/9780444823908 Verlag URL des Erstveröffentlichers Volltext http://www.sciencedirect.com/science/bookseries/01672991/108 Verlag URL des Erstveröffentlichers Volltext |
spellingShingle | Heterogeneous catalysis and fine chemicals IV proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996 SCIENCE / Chemistry / Physical & Theoretical bisacsh Heterogeneous catalysis fast Heterogeneous catalysis Congresses |
subject_GND | (DE-588)1071861417 |
title | Heterogeneous catalysis and fine chemicals IV proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996 |
title_auth | Heterogeneous catalysis and fine chemicals IV proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996 |
title_exact_search | Heterogeneous catalysis and fine chemicals IV proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996 |
title_full | Heterogeneous catalysis and fine chemicals IV proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996 editors, H.U. Blaser, A. Baiker, R. Prins |
title_fullStr | Heterogeneous catalysis and fine chemicals IV proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996 editors, H.U. Blaser, A. Baiker, R. Prins |
title_full_unstemmed | Heterogeneous catalysis and fine chemicals IV proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996 editors, H.U. Blaser, A. Baiker, R. Prins |
title_short | Heterogeneous catalysis and fine chemicals IV |
title_sort | heterogeneous catalysis and fine chemicals iv proceedings of the 4th international symposium on heterogeneous catalysis and fine chemicals basel switzerland september 8 12 1996 |
title_sub | proceedings of the 4th International Symposium on Heterogeneous Catalysis and Fine Chemicals, Basel, Switzerland, September 8-12, 1996 |
topic | SCIENCE / Chemistry / Physical & Theoretical bisacsh Heterogeneous catalysis fast Heterogeneous catalysis Congresses |
topic_facet | SCIENCE / Chemistry / Physical & Theoretical Heterogeneous catalysis Heterogeneous catalysis Congresses Konferenzschrift |
url | http://www.sciencedirect.com/science/book/9780444823908 http://www.sciencedirect.com/science/bookseries/01672991/108 |
work_keys_str_mv | AT internationalsymposiumonheterogeneouscatalysisandfinechemicals1996baselswitzerland heterogeneouscatalysisandfinechemicalsivproceedingsofthe4thinternationalsymposiumonheterogeneouscatalysisandfinechemicalsbaselswitzerlandseptember8121996 AT blaserhu heterogeneouscatalysisandfinechemicalsivproceedingsofthe4thinternationalsymposiumonheterogeneouscatalysisandfinechemicalsbaselswitzerlandseptember8121996 AT baikera heterogeneouscatalysisandfinechemicalsivproceedingsofthe4thinternationalsymposiumonheterogeneouscatalysisandfinechemicalsbaselswitzerlandseptember8121996 AT prinsroelof heterogeneouscatalysisandfinechemicalsivproceedingsofthe4thinternationalsymposiumonheterogeneouscatalysisandfinechemicalsbaselswitzerlandseptember8121996 |