The Book of noble character: critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039)
This critical Arabic text edition of K. Makarim al-akhlaq wa-mahasin al-adab wa-bada'i' al-awsaf wa-ghara'ib al-tashbihat(Book of Noble Character, Excellent Conduct, Admirable Descriptions, and Curious Similes) is a substantial work of adab attributed to the prominent littérateur Abu...
Saved in:
Main Author: | |
---|---|
Other Authors: | , |
Format: | Book |
Language: | English Arabic |
Published: |
Leiden ; Boston
Brill
[2015]
|
Series: | Islamic history and civilization
volume 120 |
Subjects: | |
Online Access: | Klappentext |
Summary: | This critical Arabic text edition of K. Makarim al-akhlaq wa-mahasin al-adab wa-bada'i' al-awsaf wa-ghara'ib al-tashbihat(Book of Noble Character, Excellent Conduct, Admirable Descriptions, and Curious Similes) is a substantial work of adab attributed to the prominent littérateur Abu Mansur al-Tha'alibi (d. 429/1039) that consists of a short introduction and three chapters. The first chapter addresses acquiring noble character and excellent conduct (al-tahalli bi-makarim al-akhlaq wa-mahasin al-adab); the second addresses shunning away from base character and ugly traits (al-tazakki 'an masawi' al-akhlaq wa-maqabih al-shiyam); and the third addresses admirable descriptions and curious similes (bada'i' al-awsaf wa-ghara'ib al-tashbihat). At the end of the text one finds a relatively large collection of widely circulating proverbs (amthal sa'ira) that are alphabetically arranged. Makarim al-akhlaq is in essence an anthology of "good conduct"; and of quotations suitable for social and literary discourse. It reflects the three ingredients of adab: behavior, literary culture, and learning. The work is introduced by an analytical study discussing the attribution of the work, the related genres, and the unique manuscript of the text |
Physical Description: | 26, 297 Seiten Faksimiles 25 cm |
ISBN: | 9004300910 9789004300910 |
Staff View
MARC
LEADER | 00000nam a2200000 cb4500 | ||
---|---|---|---|
001 | BV044007000 | ||
003 | DE-604 | ||
005 | 20220518 | ||
007 | t | ||
008 | 170120s2015 |||| |||| 00||| eng d | ||
020 | |a 9004300910 |c hardback |9 90-04-30091-0 | ||
020 | |a 9789004300910 |c : hardback |9 978-90-04-30091-0 | ||
035 | |a (OCoLC)919192085 | ||
035 | |a (DE-599)GBV84236871X | ||
040 | |a DE-604 |b ger |e rda | ||
041 | 0 | |a eng |a ara | |
049 | |a DE-29 |a DE-473 |a DE-20 |a DE-19 |a DE-355 | ||
050 | 0 | |a BJ1291 | |
082 | 0 | |a 800 | |
084 | |a EN 3208 |0 (DE-625)25375:11776 |2 rvk | ||
100 | 1 | |a Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ- |d 961-1038 |e Verfasser |0 (DE-588)118906569 |4 aut | |
245 | 1 | 0 | |a The Book of noble character |b critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) |c by Bilal Orfali, Ramzi Baalbaki |
246 | 1 | 3 | |a Makārim al-aḫlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-auṣāf wa-ġarāʾib al-tašbīhāt |
264 | 1 | |a Leiden ; Boston |b Brill |c [2015] | |
300 | |a 26, 297 Seiten |b Faksimiles |c 25 cm | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
490 | 1 | |a Islamic history and civilization |v volume 120 | |
520 | 1 | |a This critical Arabic text edition of K. Makarim al-akhlaq wa-mahasin al-adab wa-bada'i' al-awsaf wa-ghara'ib al-tashbihat(Book of Noble Character, Excellent Conduct, Admirable Descriptions, and Curious Similes) is a substantial work of adab attributed to the prominent littérateur Abu Mansur al-Tha'alibi (d. 429/1039) that consists of a short introduction and three chapters. The first chapter addresses acquiring noble character and excellent conduct (al-tahalli bi-makarim al-akhlaq wa-mahasin al-adab); the second addresses shunning away from base character and ugly traits (al-tazakki 'an masawi' al-akhlaq wa-maqabih al-shiyam); and the third addresses admirable descriptions and curious similes (bada'i' al-awsaf wa-ghara'ib al-tashbihat). At the end of the text one finds a relatively large collection of widely circulating proverbs (amthal sa'ira) that are alphabetically arranged. Makarim al-akhlaq is in essence an anthology of "good conduct"; and of quotations suitable for social and literary discourse. It reflects the three ingredients of adab: behavior, literary culture, and learning. The work is introduced by an analytical study discussing the attribution of the work, the related genres, and the unique manuscript of the text | |
546 | |a In arabischer Schrift | ||
546 | |a Text arabisch, Einleitung englisch | ||
650 | 0 | 7 | |a Ethik |0 (DE-588)4015602-3 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Moral |0 (DE-588)4040222-8 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Islam |0 (DE-588)4027743-4 |2 gnd |9 rswk-swf |
655 | 7 | |8 1\p |0 (DE-588)4135952-5 |a Quelle |2 gnd-content | |
689 | 0 | 0 | |a Islam |0 (DE-588)4027743-4 |D s |
689 | 0 | 1 | |a Ethik |0 (DE-588)4015602-3 |D s |
689 | 0 | 2 | |a Moral |0 (DE-588)4040222-8 |D s |
689 | 0 | |5 DE-604 | |
700 | 1 | |a Orfali, Bilal |d 1980- |0 (DE-588)140143777 |4 edt | |
700 | 1 | |a Baʿlabakkī, Ramzī Munīr |d 1951- |0 (DE-588)103111937X |4 edt | |
776 | 0 | 8 | |i Erscheint auch als |n Online-Ausgabe |z 978-90-04-30093-4 |
830 | 0 | |a Islamic history and civilization |v volume 120 |w (DE-604)BV008939081 |9 120 | |
856 | 4 | 2 | |m Digitalisierung UB Regensburg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029414793&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Klappentext |
999 | |a oai:aleph.bib-bvb.de:BVB01-029414793 | ||
883 | 1 | |8 1\p |a cgwrk |d 20201028 |q DE-101 |u https://d-nb.info/provenance/plan#cgwrk |
Record in the Search Index
_version_ | 1804176993227374592 |
---|---|
adam_text | This critical Arabic text edition of K. Makārim alakhlãq wa-mahãsin al-ādāb wa-badāTal-awşăfwagharďib al-tashbīhāt (Book ofNoble Character, Excellent Conduct, Admirable Descriptions, and Curious Similes) is a substantial work of adab attrib uted to the prominent littérateur Abu Mansur alTha ālibī (d. 429/1039) that consists of a short intro duction and three chapters. The first chapter addresses acquiring noble character and excellent conduct (al-tahallī bi-makārim al-akhlãq wamahãsin al-ādāb)·, the second addresses shunning away from base character and ugly traits (al-tazakki ‘an masäwľ al-akhlãq wa֊maqābih al-shiyam); and the third addresses admirable descriptions and curious similes {badä’ľal-awşâfwa-ghara’ib altashbihāt). At the end of the text one finds a rela tively large collection of widely circulating proverbs (amthāl sā’ira) that are alphabetically arranged. Makãrím al-akhlãq is in essence an anthology of “good conduct” and of quotations suitable for social and literary discourse. It reflects the three ingredi ents of adab: behavior, literary culture, and learn ing. The work is introduced by an analytical study discussing the attribution of the work, the related genres, and the unique manuscript of the text.
|
any_adam_object | 1 |
author | Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ- 961-1038 |
author2 | Orfali, Bilal 1980- Baʿlabakkī, Ramzī Munīr 1951- |
author2_role | edt edt |
author2_variant | b o bo r m b rm rmb |
author_GND | (DE-588)118906569 (DE-588)140143777 (DE-588)103111937X |
author_facet | Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ- 961-1038 Orfali, Bilal 1980- Baʿlabakkī, Ramzī Munīr 1951- |
author_role | aut |
author_sort | Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ- 961-1038 |
author_variant | ʿ a i m a ṯ ʿaima ʿaimaṯ |
building | Verbundindex |
bvnumber | BV044007000 |
callnumber-first | B - Philosophy, Psychology, Religion |
callnumber-label | BJ1291 |
callnumber-raw | BJ1291 |
callnumber-search | BJ1291 |
callnumber-sort | BJ 41291 |
callnumber-subject | BJ - Ethics |
classification_rvk | EN 3208 |
ctrlnum | (OCoLC)919192085 (DE-599)GBV84236871X |
dewey-full | 800 |
dewey-hundreds | 800 - Literature (Belles-lettres) and rhetoric |
dewey-ones | 800 - Literature (Belles-lettres) and rhetoric |
dewey-raw | 800 |
dewey-search | 800 |
dewey-sort | 3800 |
dewey-tens | 800 - Literature (Belles-lettres) and rhetoric |
discipline | Außereuropäische Sprachen und Literaturen Literaturwissenschaft |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03735nam a2200529 cb4500</leader><controlfield tag="001">BV044007000</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20220518 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">170120s2015 |||| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9004300910</subfield><subfield code="c">hardback</subfield><subfield code="9">90-04-30091-0</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789004300910</subfield><subfield code="c">: hardback</subfield><subfield code="9">978-90-04-30091-0</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)919192085</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)GBV84236871X</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield><subfield code="a">ara</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-29</subfield><subfield code="a">DE-473</subfield><subfield code="a">DE-20</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-355</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">BJ1291</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">800</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">EN 3208</subfield><subfield code="0">(DE-625)25375:11776</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ-</subfield><subfield code="d">961-1038</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)118906569</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The Book of noble character</subfield><subfield code="b">critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039)</subfield><subfield code="c">by Bilal Orfali, Ramzi Baalbaki</subfield></datafield><datafield tag="246" ind1="1" ind2="3"><subfield code="a">Makārim al-aḫlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-auṣāf wa-ġarāʾib al-tašbīhāt</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Leiden ; Boston</subfield><subfield code="b">Brill</subfield><subfield code="c">[2015]</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">26, 297 Seiten</subfield><subfield code="b">Faksimiles</subfield><subfield code="c">25 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Islamic history and civilization</subfield><subfield code="v">volume 120</subfield></datafield><datafield tag="520" ind1="1" ind2=" "><subfield code="a">This critical Arabic text edition of K. Makarim al-akhlaq wa-mahasin al-adab wa-bada'i' al-awsaf wa-ghara'ib al-tashbihat(Book of Noble Character, Excellent Conduct, Admirable Descriptions, and Curious Similes) is a substantial work of adab attributed to the prominent littérateur Abu Mansur al-Tha'alibi (d. 429/1039) that consists of a short introduction and three chapters. The first chapter addresses acquiring noble character and excellent conduct (al-tahalli bi-makarim al-akhlaq wa-mahasin al-adab); the second addresses shunning away from base character and ugly traits (al-tazakki 'an masawi' al-akhlaq wa-maqabih al-shiyam); and the third addresses admirable descriptions and curious similes (bada'i' al-awsaf wa-ghara'ib al-tashbihat). At the end of the text one finds a relatively large collection of widely circulating proverbs (amthal sa'ira) that are alphabetically arranged. Makarim al-akhlaq is in essence an anthology of "good conduct"; and of quotations suitable for social and literary discourse. It reflects the three ingredients of adab: behavior, literary culture, and learning. The work is introduced by an analytical study discussing the attribution of the work, the related genres, and the unique manuscript of the text</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">In arabischer Schrift</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">Text arabisch, Einleitung englisch</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Ethik</subfield><subfield code="0">(DE-588)4015602-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Moral</subfield><subfield code="0">(DE-588)4040222-8</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Islam</subfield><subfield code="0">(DE-588)4027743-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="8">1\p</subfield><subfield code="0">(DE-588)4135952-5</subfield><subfield code="a">Quelle</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Islam</subfield><subfield code="0">(DE-588)4027743-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Ethik</subfield><subfield code="0">(DE-588)4015602-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Moral</subfield><subfield code="0">(DE-588)4040222-8</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Orfali, Bilal</subfield><subfield code="d">1980-</subfield><subfield code="0">(DE-588)140143777</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Baʿlabakkī, Ramzī Munīr</subfield><subfield code="d">1951-</subfield><subfield code="0">(DE-588)103111937X</subfield><subfield code="4">edt</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe</subfield><subfield code="z">978-90-04-30093-4</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Islamic history and civilization</subfield><subfield code="v">volume 120</subfield><subfield code="w">(DE-604)BV008939081</subfield><subfield code="9">120</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Regensburg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029414793&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Klappentext</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029414793</subfield></datafield><datafield tag="883" ind1="1" ind2=" "><subfield code="8">1\p</subfield><subfield code="a">cgwrk</subfield><subfield code="d">20201028</subfield><subfield code="q">DE-101</subfield><subfield code="u">https://d-nb.info/provenance/plan#cgwrk</subfield></datafield></record></collection> |
genre | 1\p (DE-588)4135952-5 Quelle gnd-content |
genre_facet | Quelle |
id | DE-604.BV044007000 |
illustrated | Not Illustrated |
indexdate | 2024-07-10T07:41:00Z |
institution | BVB |
isbn | 9004300910 9789004300910 |
language | English Arabic |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029414793 |
oclc_num | 919192085 |
open_access_boolean | |
owner | DE-29 DE-473 DE-BY-UBG DE-20 DE-19 DE-BY-UBM DE-355 DE-BY-UBR |
owner_facet | DE-29 DE-473 DE-BY-UBG DE-20 DE-19 DE-BY-UBM DE-355 DE-BY-UBR |
physical | 26, 297 Seiten Faksimiles 25 cm |
publishDate | 2015 |
publishDateSearch | 2015 |
publishDateSort | 2015 |
publisher | Brill |
record_format | marc |
series | Islamic history and civilization |
series2 | Islamic history and civilization |
spelling | Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ- 961-1038 Verfasser (DE-588)118906569 aut The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) by Bilal Orfali, Ramzi Baalbaki Makārim al-aḫlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-auṣāf wa-ġarāʾib al-tašbīhāt Leiden ; Boston Brill [2015] 26, 297 Seiten Faksimiles 25 cm txt rdacontent n rdamedia nc rdacarrier Islamic history and civilization volume 120 This critical Arabic text edition of K. Makarim al-akhlaq wa-mahasin al-adab wa-bada'i' al-awsaf wa-ghara'ib al-tashbihat(Book of Noble Character, Excellent Conduct, Admirable Descriptions, and Curious Similes) is a substantial work of adab attributed to the prominent littérateur Abu Mansur al-Tha'alibi (d. 429/1039) that consists of a short introduction and three chapters. The first chapter addresses acquiring noble character and excellent conduct (al-tahalli bi-makarim al-akhlaq wa-mahasin al-adab); the second addresses shunning away from base character and ugly traits (al-tazakki 'an masawi' al-akhlaq wa-maqabih al-shiyam); and the third addresses admirable descriptions and curious similes (bada'i' al-awsaf wa-ghara'ib al-tashbihat). At the end of the text one finds a relatively large collection of widely circulating proverbs (amthal sa'ira) that are alphabetically arranged. Makarim al-akhlaq is in essence an anthology of "good conduct"; and of quotations suitable for social and literary discourse. It reflects the three ingredients of adab: behavior, literary culture, and learning. The work is introduced by an analytical study discussing the attribution of the work, the related genres, and the unique manuscript of the text In arabischer Schrift Text arabisch, Einleitung englisch Ethik (DE-588)4015602-3 gnd rswk-swf Moral (DE-588)4040222-8 gnd rswk-swf Islam (DE-588)4027743-4 gnd rswk-swf 1\p (DE-588)4135952-5 Quelle gnd-content Islam (DE-588)4027743-4 s Ethik (DE-588)4015602-3 s Moral (DE-588)4040222-8 s DE-604 Orfali, Bilal 1980- (DE-588)140143777 edt Baʿlabakkī, Ramzī Munīr 1951- (DE-588)103111937X edt Erscheint auch als Online-Ausgabe 978-90-04-30093-4 Islamic history and civilization volume 120 (DE-604)BV008939081 120 Digitalisierung UB Regensburg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029414793&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Klappentext 1\p cgwrk 20201028 DE-101 https://d-nb.info/provenance/plan#cgwrk |
spellingShingle | Ṯaʿālibī, ʿAbd-al-Malik Ibn-Muḥammad aṯ- 961-1038 The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) Islamic history and civilization Ethik (DE-588)4015602-3 gnd Moral (DE-588)4040222-8 gnd Islam (DE-588)4027743-4 gnd |
subject_GND | (DE-588)4015602-3 (DE-588)4040222-8 (DE-588)4027743-4 (DE-588)4135952-5 |
title | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) |
title_alt | Makārim al-aḫlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-auṣāf wa-ġarāʾib al-tašbīhāt |
title_auth | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) |
title_exact_search | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) |
title_full | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) by Bilal Orfali, Ramzi Baalbaki |
title_fullStr | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) by Bilal Orfali, Ramzi Baalbaki |
title_full_unstemmed | The Book of noble character critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) by Bilal Orfali, Ramzi Baalbaki |
title_short | The Book of noble character |
title_sort | the book of noble character critical edition of makarim al akhlaq wa mahasin al adab wa badaʾiʿ al awsaf wa gharaʾib al tashbihat attributed to abu mansur al thaʿalibi d 429 1039 |
title_sub | critical edition of Makārim al-akhlāq wa-maḥāsin al-ādāb wa-badāʾiʿ al-awṣāf wa-gharāʾib al-tashbīhāt : attributed to Abū Manṣūr al-Thaʿālibī (d. 429/1039) |
topic | Ethik (DE-588)4015602-3 gnd Moral (DE-588)4040222-8 gnd Islam (DE-588)4027743-4 gnd |
topic_facet | Ethik Moral Islam Quelle |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029414793&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
volume_link | (DE-604)BV008939081 |
work_keys_str_mv | AT taʿalibiʿabdalmalikibnmuhammadat thebookofnoblecharactercriticaleditionofmakarimalakhlaqwamahasinaladabwabadaʾiʿalawsafwagharaʾibaltashbihatattributedtoabumansuralthaʿalibid4291039 AT orfalibilal thebookofnoblecharactercriticaleditionofmakarimalakhlaqwamahasinaladabwabadaʾiʿalawsafwagharaʾibaltashbihatattributedtoabumansuralthaʿalibid4291039 AT baʿlabakkiramzimunir thebookofnoblecharactercriticaleditionofmakarimalakhlaqwamahasinaladabwabadaʾiʿalawsafwagharaʾibaltashbihatattributedtoabumansuralthaʿalibid4291039 AT taʿalibiʿabdalmalikibnmuhammadat makarimalahlaqwamahasinaladabwabadaʾiʿalausafwagaraʾibaltasbihat AT orfalibilal makarimalahlaqwamahasinaladabwabadaʾiʿalausafwagaraʾibaltasbihat AT baʿlabakkiramzimunir makarimalahlaqwamahasinaladabwabadaʾiʿalausafwagaraʾibaltasbihat |