High speed railway track dynamics: models, algorithms and applications
Saved in:
| Main Author: | |
|---|---|
| Format: | Electronic eBook |
| Language: | English |
| Published: |
Singapore
Springer
2017
|
| Subjects: | |
| Online Access: | BTU01 FAB01 FAW01 FHA01 FHI01 FHN01 FHR01 FKE01 FLA01 FRO01 FWS01 FWS02 TUM01 UBY01 Volltext Inhaltsverzeichnis |
| Physical Description: | 1 Online-Ressource (xxii, 414 Seiten) Illustrationen, Diagramme |
| ISBN: | 9789811020391 |
| DOI: | 10.1007/978-981-10-2039-1 |
Staff View
MARC
| LEADER | 00000nmm a2200000zc 4500 | ||
|---|---|---|---|
| 001 | BV043861915 | ||
| 003 | DE-604 | ||
| 005 | 20181214 | ||
| 007 | cr|uuu---uuuuu | ||
| 008 | 161107s2017 |||| o||u| ||||||eng d | ||
| 020 | |a 9789811020391 |c Online |9 978-981-10-2039-1 | ||
| 024 | 7 | |a 10.1007/978-981-10-2039-1 |2 doi | |
| 035 | |a (ZDB-2-ENG)9789811020391 | ||
| 035 | |a (OCoLC)960019107 | ||
| 035 | |a (DE-599)BVBBV043861915 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-859 |a DE-1046 |a DE-860 |a DE-898 |a DE-706 |a DE-92 |a DE-1043 |a DE-91 |a DE-634 |a DE-Aug4 |a DE-861 |a DE-863 |a DE-862 |a DE-573 | ||
| 082 | 0 | |a 629.04 |2 23 | |
| 084 | |a ZO 5110 |0 (DE-625)157754: |2 rvk | ||
| 084 | |a MAS 000 |2 stub | ||
| 084 | |a ELT 000 |2 stub | ||
| 100 | 1 | |a Lei, Xiaoyan |e Verfasser |4 aut | |
| 245 | 1 | 0 | |a High speed railway track dynamics |b models, algorithms and applications |c Xiaoyan Lei |
| 264 | 1 | |a Singapore |b Springer |c 2017 | |
| 300 | |a 1 Online-Ressource (xxii, 414 Seiten) |b Illustrationen, Diagramme | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b c |2 rdamedia | ||
| 338 | |b cr |2 rdacarrier | ||
| 650 | 4 | |a Engineering | |
| 650 | 4 | |a Applied mathematics | |
| 650 | 4 | |a Engineering mathematics | |
| 650 | 4 | |a Vibration | |
| 650 | 4 | |a Dynamical systems | |
| 650 | 4 | |a Dynamics | |
| 650 | 4 | |a Transportation engineering | |
| 650 | 4 | |a Traffic engineering | |
| 650 | 4 | |a Transportation Technology and Traffic Engineering | |
| 650 | 4 | |a Vibration, Dynamical Systems, Control | |
| 650 | 4 | |a Applications of Nonlinear Dynamics and Chaos Theory | |
| 650 | 4 | |a Appl.Mathematics/Computational Methods of Engineering | |
| 650 | 4 | |a Ingenieurwissenschaften | |
| 650 | 0 | 7 | |a Gleisanlage |0 (DE-588)4113760-7 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Schnellfahrstrecke |0 (DE-588)4660106-5 |2 gnd |9 rswk-swf |
| 689 | 0 | 0 | |a Schnellfahrstrecke |0 (DE-588)4660106-5 |D s |
| 689 | 0 | 1 | |a Gleisanlage |0 (DE-588)4113760-7 |D s |
| 689 | 0 | |8 1\p |5 DE-604 | |
| 776 | 0 | 8 | |i Erscheint auch als |n Druck-Ausgabe |z 978-981-10-2037-7 |
| 856 | 4 | 0 | |u https://doi.org/10.1007/978-981-10-2039-1 |x Verlag |z URL des Erstveröffentlichers |3 Volltext |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029271989&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 912 | |a ZDB-2-ENG | ||
| 940 | 1 | |q ZDB-2-ENG_2017 | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-029271989 | ||
| 883 | 1 | |8 1\p |a cgwrk |d 20201028 |q DE-101 |u https://d-nb.info/provenance/plan#cgwrk | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l BTU01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l FAB01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l FAW01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l FHA01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l FHI01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l FHN01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l FHR01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l FKE01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l FLA01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l FRO01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l FWS01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l FWS02 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l TUM01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
| 966 | e | |u https://doi.org/10.1007/978-981-10-2039-1 |l UBY01 |p ZDB-2-ENG |x Verlag |3 Volltext | |
Record in the Search Index
| DE-BY-FWS_katkey | 630293 |
|---|---|
| _version_ | 1824554547337494528 |
| adam_text | Titel: High speed railway track dynamics
Autor: Lei, Xiaoyan
Jahr: 2017
Contents
1 Track Dynamics Research Contents and Related Standards 1
1.1 A Review of Track Dynamics Research 1
1.2 Track Dynamics Research Contents 6
1.3 Limits for Safety and Riding Quality and Railway
Environmental Standards 7
1.3.1 Safety Limit for Regular Trains 7
1.3.2 Riding Quality Limits for Regular Trains 8
1.3.3 Safety and Riding Quality Limit for Rising
Speed Trains 10
1.3.4 Railway Noise Standards in China 11
1.3.5 Railway Noise Standards in Foreign Countries 11
1.3.6 Noise Limit for Railway Locomotives
and Passenger Trains in China 12
1.3.7 Environmental Vibration Standards in China s
Urban Areas 14
1.3.8 Limit for Building Vibration Caused by Urban
Mass Transit 18
1.4 Standards of Track Maintenance for High-Speed Railway 19
1.4.1 Standards of Track Maintenance for French
High-Speed Railway 20
1.4.2 Standards of Track Maintenance and Management
for Japanese Shinkansen High-Speed Railway 20
1.4.3 Standards of Track Maintenance and Management
for German High-Speed Railway 21
1.4.4 Standards of Track Maintenance and Management
for British High-Speed Railway 23
xiii
xiv Contents
1.4.5 The Measuring Standards of Track Geometry
for Korean High-Speed Railway (Dynamic) 24
1.4.6 Standards of Track Maintenance for Chinese
High-Speed Railway 25
1.4.7 The Dominant Frequency Range and Sensitive
Wavelength of European High-Speed Train
and Track Coupling System 25
1.5 Vibration Standards of Historic Building Structures 28
References 33
2 Analytic Method for Dynamic Analysis of the Track Structure.... 37
2.1 Studies of Ground Surface Wave and Strong Track
Vibration Induced by High-Speed Train 37
2.1.1 The Continuous Elastic Beam Model of Track
Structure 38
2.1.2 Track Equivalent Stiffness and Track Foundation
Elasticity Modulus 40
2.1.3 Track Critical Velocity 41
2.1.4 Analysis of Strong Track Vibration 41
2.2 Effects of Track Stiffness Abrupt Change on Track
Vibration 44
2.2.1 Track Vibration Model in Consideration
of Track Irregularity and Stiffness Abrupt
Change Under Moving Loads 44
2.2.2 The Reasonable Distribution of the Track
Stiffness in Transition 53
References 56
3 Fourier Transform Method for Dynamic Analysis
of the Track Structure 57
3.1 Model of Single-Layer Continuous Elastic Beam
for the Track Structure 57
3.1.1 Fourier Transform 58
3.1.2 Inverse Discrete Fourier Transform 60
3.1.3 Definition of Inverse Discrete Fourier Transform
in MATLAB 61
3.2 Model of Double-Layer Continuous Elastic Beam
for the Track Structure 62
3.3 Analysis of High-Speed Railway Track Vibration
and Track Critical Velocity 64
3.3.1 Analysis of the Single-Layer Continuous
Elastic Beam Model 64
Contents xv
3.4 Vibration Analysis of Track for Railways with Mixed
Passenger and Freight Traffic 86
3.4.1 Three-Layer Continuous Elastic Beam Model
of Track Structure 86
3.4.2 Numerical Simulation of Track Random
Irregularity 87
3.4.3 Fourier Transform for Solving Three-Layer
Continuous Elastic Beam Model of Track
Structure 89
3.5 Vibration Analysis of Ballast Track with Asphalt
Trackbed Over Soft Subgrade 94
3.5.1 Four-Layer Continuous Elastic Beam Model
of Track Structure 95
3.5.2 Fourier Transform for Solving Four-Layer
Continuous Elastic Beam Model of Track
Structure 96
3.5.3 Vibration Analysis of Ballast Track
with Asphalt Trackbed Over Soft Subgrade 99
References 105
4 Analysis of Vibration Behavior of the Elevated Track
Structure 107
4.1 Basic Concept of Admittance 107
4.1.1 Definition of Admittance 107
4.1.2 Computational Method of Admittance 108
4.1.3 Basic Theory of Harmonic Response Analysis 109
4.2 Analysis of Vibration Behavior of the Elevated Bridge
Structure 110
4.2.1 Analytic Beam Model Ill
4.2.2 Finite Element Model 115
4.2.3 Comparison Between Analytic Model and Finite
Element Model of the Elevated Track-Bridge 116
4.2.4 The Influence of the Bridge Bearing Stiffness 117
4.2.5 The Influence of the Bridge Cross Section Model.... 117
4.3 Analysis of Vibration Behavior of the Elevated Track
Structure 120
4.3.1 Analytic Model of the Elevated Track-Bridge
System 120
4.3.2 Finite Element Model 124
4.3.3 Damping of the Bridge Structure 124
4.3.4 Parameter Analysis of the Elevated Track-Bridge
System 127
4.4 Analysis of Vibration Attenuation Behavior of the Elevated
Track Structure 131
xvi Contents
4.4.1 The Attenuation Rate of Vibration Transmission 131
4.4.2 Attenuation Coefficient of Rail Vibration 135
References 136
5 Track Irregularity Power Spectrum and Numerical Simulation ... 137
5.1 Basic Concept of Random Process 138
5.1.1 Stationary Random Process 139
5.1.2 Ergodic 140
5.2 Random Irregularity Power Spectrum of the Track
Structure 140
5.2.1 American Track Irregularity Power Spectrum 141
5.2.2 Track Irregularity Power Spectrum for German
High-Speed Railways [5] 142
5.2.3 Japanese Track Irregularity Sato Spectrum 143
5.2.4 Chinese Trunk Track Irregularity Spectrum 144
5.2.5 The Track Irregularity Spectrum of Hefei-Wuhan
Passenger-Dedicated Line [10] 146
5.2.6 Comparison of the Track Irregularity Power
Spectrum Fitting Curves 149
5.3 Numerical Simulation for Random Irregularity
of the Track Structure 156
5.4 Trigonometric Series Method 157
5.4.1 Trigonometric Series Method (1) 157
5.4.2 Trigonometric Series Method (2) 158
5.4.3 Trigonometric Series Method (3) 158
5.4.4 Trigonometric Series Method (4) 159
5.4.5 Sample of the Track Structure Random
Irregularity 160
References 160
6 Model for Vertical Dynamic Analysis of the Vehicle-Track
Coupling System 161
6.1 Fundamental Theory of Dynamic Finite Element Method 162
6.1.1 A Brief Introduction to Dynamic Finite Element
Method 162
6.1.2 Beam Element Theory 166
6.2 Finite Element Equation of the Track Structure 172
6.2.1 Basic Assumptions and Computing Model 172
6.2.2 Theory of Generalized Beam Element of Track
Structure 173
6.3 Model of Track Dynamics Under Moving Axle Loads 178
6.4 Vehicle Model of a Single Wheel With Primary
Suspension System 180
6.5 Vehicle Model of Half a Car With Primary and Secondary
Suspension System 182
Contents xvii
6.6 Vehicle Model of a Whole Car With Primary and Secondary
Suspension System 184
6.7 Parameters for Vehicle and Track Structure 187
6.7.1 Basic Parameters of Locomotives and Vehicles 187
6.7.2 Basic Parameters of the Track Structure 189
References 198
7 A Cross-Iteration Algorithm for Vehicle-Track Coupling
Vibration Analysis 201
7.1 A Cross-Iteration Algorithm for Vehicle-Track Nonlinear
Coupling System 201
7.2 Example Validation 207
7.2.1 Verification 207
7.2.2 The Influence of Time Step 210
7.2.3 The Influence of Convergence Precision 211
7.3 Dynamic Analysis of the Train-Track Nonlinear Coupling
System 212
7.4 Conclusions 218
References 220
8 Moving Element Model and Its Algorithm 221
8.1 Moving Element Model 221
8.2 Moving Element Model of a Single Wheel with Primary
Suspension System 224
8.3 Moving Element Model of a Single Wheel with Primary
and Secondary Suspension Systems 227
8.4 Model and Algorithm for Dynamic Analysis of a Single
Wheel Moving on the Bridge 231
References 234
9 Model and Algorithm for Track Element and Vehicle Element... . 235
9.1 Ballast Track Element Model 236
9.1.1 Basic Assumptions 236
9.1.2 Three-Layer Ballast Track Element 236
9.2 Slab Track Element Model 239
9.2.1 Basic Assumptions 239
9.2.2 Three-Layer Slab Track Element Model 240
9.2.3 Mass Matrix of the Slab Track Element 241
9.2.4 Stiffness Matrix of the Slab Track Element 242
9.2.5 Damping Matrix of the Slab Track Element 246
9.3 Slab Track-Bridge Element Model 248
9.3.1 Basic Assumptions 248
9.3.2 Three-Layer Slab Track and Bridge Element
Model 248
9.3.3 Mass Matrix of the Slab Track-Bridge Element 249
9.3.4 Stiffness Matrix of the Slab Track-Bridge Element.. . 250
xviii Contents
9.3.5 Damping Matrix of the Slab Track-Bride Element .. . 253
9.4 Vehicle Element Model 254
9.4.1 Potential Energy of the Vehicle Element 256
9.4.2 Kinetic Energy of the Vehicle Element 260
9.4.3 Dissipated Energy of the Vehicle Element 260
9.5 Finite Element Equation of the Vehicle-Track Coupling
System 261
9.6 Dynamic Analysis of the Train and Track Coupling System ... 262
References 269
10 Dynamic Analysis of the Vehicle-Track Coupling System
with Finite Elements in a Moving Frame of Reference 271
10.1 Basic Assumptions 272
10.2 Three-Layer Beam Element Model of the Slab Track
in a Moving Frame of Reference 272
10.2.1 Governing Equation of the Slab Track 273
10.2.2 Element Mass, Damping, and Stiffness Matrixes
of the Slab Track in a Moving Frame
of Reference 276
10.3 Vehicle Element Model 289
10.4 Finite Element Equation of the Vehicle-Slab Track
Coupling System 289
10.5 Algorithm Verification 290
10.6 Dynamic Analysis of High-Speed Train and Slab Track
Coupling System 292
References 299
11 Model for Vertical Dynamic Analysis
of the Vehicle-Track-Subgrade-Ground Coupling System 301
11.1 Model of the Slab Track-Embankment-Ground System
Under Moving Loads 301
11.1.1 Dynamic Equation and Its Solution
for the Slab Track-Subgrade Bed System 302
11.1.2 Dynamic Equation and Its Solution
for the Embankment Body-Ground System 305
11.1.3 Coupling Vibration of the Slab
Track-Embankment-Ground System 307
11.2 Model of the Ballast Track-Embankment-Ground System
Under Moving Loads 309
11.2.1 Dynamic Equation and Its Solution for the Ballast
Track-Subgrade Bed System 310
11.2.2 Coupling Vibration of the Ballast
Track-Embankment-Ground System 312
11.3 Analytic Vibration Model of the Moving
Vehicle-Track-Subgrade-Ground Coupling System 313
Contents xix
11.3.1 Flexibility Matrix of Moving Vehicles
at Wheelset Points 313
11.3.2 Flexibility Matrix of the Track-Subgrade-Ground
System at Wheel-Rail Contact Points 316
11.3.3 Coupling of Moving Vehicle-Subgrade-Ground
System by Consideration of Track Irregularities 317
11.4 Dynamic Analysis of the High-Speed Train-Track-Subgrade-
Ground Coupling System 318
11.4.1 Influence of Train Speed and Track Irregularity
on Embankment Body Vibration 318
11.4.2 Influence of Subgrade Bed Stiffness
on Embankment Body Vibration 320
11.4.3 Influence of Embankment Soil Stiffness on
Embankment Body Vibration 321
References 322
12 Analysis of Dynamic Behavior of the Train, Ballast Track,
and Subgrade Coupling System 323
12.1 Parameters for Vehicle and Track Structure 323
12.2 Influence Analysis of the Train Speed 324
12.3 Influence Analysis of the Track Stiffness Distribution 326
12.4 Influence Analysis of the Transition Irregularity 330
12.5 Influence Analysis of the Combined Track Stiffness
and Transition Irregularity 336
References 340
13 Analysis of Dynamic Behavior of the Train, Slab Track,
and Subgrade Coupling System 341
13.1 Example Validation 342
13.2 Parameter Analysis of Dynamic Behavior of the Train,
Slab Track, and Subgrade Coupling System 344
13.3 Influence of the Rail Pad and Fastener Stiffness 345
13.4 Influence of the Rail Pad and Fastener Damping 347
13.5 Influence of the CA Mortar Stiffness 350
13.6 Influence of the CA Mortar Damping 353
13.7 Influence of the Subgrade Stiffness 355
13.8 Influence of the Subgrade Damping 359
References 364
14 Analysis of Dynamic Behavior of the Transition Section
Between Ballast Track and Ballastless Track 365
14.1 Influence Analysis of the Train Speed for the Transition
Section Between the Ballast Track and the Ballastless
Track 366
xx Contents
14.2 Influence Analysis of the Track Foundation Stiffness
for the Transition Section between the Ballast Track
and the Ballastless Track 369
14.3 Remediation Measures of the Transition Section
between the Ballast Track and the Ballastless Track 372
References 376
15 Environmental Vibration Analysis Induced by Overlapping
Subways 377
15.1 Vibration Analysis of the Ground Induced by Overlapping
Subways 378
15.1.1 Project Profile 378
15.1.2 Material Parameters 378
15.1.3 Finite Element Model 380
15.1.4 Damping Coefficient and Integration Step 381
15.1.5 Vehicle Dynamic Load 382
15.1.6 Environmental Vibration Evaluation Index 383
15.1.7 Influence of Operation Direction of Uplink
and Downlink on Vibration 384
15.1.8 Vibration Reduction Scheme Analysis
for Overlapping Subways 386
15.1.9 Vibration Frequency Analysis 389
15.1.10 Ground Vibration Distribution Characteristics 390
15.2 Vibration Analysis of the Historic Building Induced
by Overlapping Subways 391
15.2.1 Project Profile 391
15.2.2 Finite Element Model 392
15.2.3 Modal Analysis of Building 393
15.2.4 Horizontal Vibration Analysis of the Building 395
15.2.5 Vertical Vibration Analysis of the Building 400
15.3 Conclusions 405
References 406
Index 409
|
| any_adam_object | 1 |
| author | Lei, Xiaoyan |
| author_facet | Lei, Xiaoyan |
| author_role | aut |
| author_sort | Lei, Xiaoyan |
| author_variant | x l xl |
| building | Verbundindex |
| bvnumber | BV043861915 |
| classification_rvk | ZO 5110 |
| classification_tum | MAS 000 ELT 000 |
| collection | ZDB-2-ENG |
| ctrlnum | (ZDB-2-ENG)9789811020391 (OCoLC)960019107 (DE-599)BVBBV043861915 |
| dewey-full | 629.04 |
| dewey-hundreds | 600 - Technology (Applied sciences) |
| dewey-ones | 629 - Other branches of engineering |
| dewey-raw | 629.04 |
| dewey-search | 629.04 |
| dewey-sort | 3629.04 |
| dewey-tens | 620 - Engineering and allied operations |
| discipline | Elektrotechnik Verkehr / Transport Maschinenbau |
| doi_str_mv | 10.1007/978-981-10-2039-1 |
| format | Electronic eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03833nmm a2200781zc 4500</leader><controlfield tag="001">BV043861915</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20181214 </controlfield><controlfield tag="007">cr|uuu---uuuuu</controlfield><controlfield tag="008">161107s2017 |||| o||u| ||||||eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789811020391</subfield><subfield code="c">Online</subfield><subfield code="9">978-981-10-2039-1</subfield></datafield><datafield tag="024" ind1="7" ind2=" "><subfield code="a">10.1007/978-981-10-2039-1</subfield><subfield code="2">doi</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ZDB-2-ENG)9789811020391</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)960019107</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043861915</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-859</subfield><subfield code="a">DE-1046</subfield><subfield code="a">DE-860</subfield><subfield code="a">DE-898</subfield><subfield code="a">DE-706</subfield><subfield code="a">DE-92</subfield><subfield code="a">DE-1043</subfield><subfield code="a">DE-91</subfield><subfield code="a">DE-634</subfield><subfield code="a">DE-Aug4</subfield><subfield code="a">DE-861</subfield><subfield code="a">DE-863</subfield><subfield code="a">DE-862</subfield><subfield code="a">DE-573</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">629.04</subfield><subfield code="2">23</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">ZO 5110</subfield><subfield code="0">(DE-625)157754:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">MAS 000</subfield><subfield code="2">stub</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">ELT 000</subfield><subfield code="2">stub</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Lei, Xiaoyan</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">High speed railway track dynamics</subfield><subfield code="b">models, algorithms and applications</subfield><subfield code="c">Xiaoyan Lei</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Singapore</subfield><subfield code="b">Springer</subfield><subfield code="c">2017</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 Online-Ressource (xxii, 414 Seiten)</subfield><subfield code="b">Illustrationen, Diagramme</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Engineering</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Applied mathematics</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Engineering mathematics</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Vibration</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Dynamical systems</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Dynamics</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Transportation engineering</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Traffic engineering</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Transportation Technology and Traffic Engineering</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Vibration, Dynamical Systems, Control</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Applications of Nonlinear Dynamics and Chaos Theory</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Appl.Mathematics/Computational Methods of Engineering</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Ingenieurwissenschaften</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Gleisanlage</subfield><subfield code="0">(DE-588)4113760-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Schnellfahrstrecke</subfield><subfield code="0">(DE-588)4660106-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Schnellfahrstrecke</subfield><subfield code="0">(DE-588)4660106-5</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Gleisanlage</subfield><subfield code="0">(DE-588)4113760-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="8">1\p</subfield><subfield code="5">DE-604</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Druck-Ausgabe</subfield><subfield code="z">978-981-10-2037-7</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="x">Verlag</subfield><subfield code="z">URL des Erstveröffentlichers</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029271989&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-2-ENG</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">ZDB-2-ENG_2017</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029271989</subfield></datafield><datafield tag="883" ind1="1" ind2=" "><subfield code="8">1\p</subfield><subfield code="a">cgwrk</subfield><subfield code="d">20201028</subfield><subfield code="q">DE-101</subfield><subfield code="u">https://d-nb.info/provenance/plan#cgwrk</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">BTU01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">FAB01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">FAW01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">FHA01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">FHI01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">FHN01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">FHR01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">FKE01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">FLA01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">FRO01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">FWS01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">FWS02</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">TUM01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">https://doi.org/10.1007/978-981-10-2039-1</subfield><subfield code="l">UBY01</subfield><subfield code="p">ZDB-2-ENG</subfield><subfield code="x">Verlag</subfield><subfield code="3">Volltext</subfield></datafield></record></collection> |
| id | DE-604.BV043861915 |
| illustrated | Not Illustrated |
| indexdate | 2025-02-20T06:53:30Z |
| institution | BVB |
| isbn | 9789811020391 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029271989 |
| oclc_num | 960019107 |
| open_access_boolean | |
| owner | DE-859 DE-1046 DE-860 DE-898 DE-BY-UBR DE-706 DE-92 DE-1043 DE-91 DE-BY-TUM DE-634 DE-Aug4 DE-861 DE-863 DE-BY-FWS DE-862 DE-BY-FWS DE-573 |
| owner_facet | DE-859 DE-1046 DE-860 DE-898 DE-BY-UBR DE-706 DE-92 DE-1043 DE-91 DE-BY-TUM DE-634 DE-Aug4 DE-861 DE-863 DE-BY-FWS DE-862 DE-BY-FWS DE-573 |
| physical | 1 Online-Ressource (xxii, 414 Seiten) Illustrationen, Diagramme |
| psigel | ZDB-2-ENG ZDB-2-ENG_2017 |
| publishDate | 2017 |
| publishDateSearch | 2017 |
| publishDateSort | 2017 |
| publisher | Springer |
| record_format | marc |
| spellingShingle | Lei, Xiaoyan High speed railway track dynamics models, algorithms and applications Engineering Applied mathematics Engineering mathematics Vibration Dynamical systems Dynamics Transportation engineering Traffic engineering Transportation Technology and Traffic Engineering Vibration, Dynamical Systems, Control Applications of Nonlinear Dynamics and Chaos Theory Appl.Mathematics/Computational Methods of Engineering Ingenieurwissenschaften Gleisanlage (DE-588)4113760-7 gnd Schnellfahrstrecke (DE-588)4660106-5 gnd |
| subject_GND | (DE-588)4113760-7 (DE-588)4660106-5 |
| title | High speed railway track dynamics models, algorithms and applications |
| title_auth | High speed railway track dynamics models, algorithms and applications |
| title_exact_search | High speed railway track dynamics models, algorithms and applications |
| title_full | High speed railway track dynamics models, algorithms and applications Xiaoyan Lei |
| title_fullStr | High speed railway track dynamics models, algorithms and applications Xiaoyan Lei |
| title_full_unstemmed | High speed railway track dynamics models, algorithms and applications Xiaoyan Lei |
| title_short | High speed railway track dynamics |
| title_sort | high speed railway track dynamics models algorithms and applications |
| title_sub | models, algorithms and applications |
| topic | Engineering Applied mathematics Engineering mathematics Vibration Dynamical systems Dynamics Transportation engineering Traffic engineering Transportation Technology and Traffic Engineering Vibration, Dynamical Systems, Control Applications of Nonlinear Dynamics and Chaos Theory Appl.Mathematics/Computational Methods of Engineering Ingenieurwissenschaften Gleisanlage (DE-588)4113760-7 gnd Schnellfahrstrecke (DE-588)4660106-5 gnd |
| topic_facet | Engineering Applied mathematics Engineering mathematics Vibration Dynamical systems Dynamics Transportation engineering Traffic engineering Transportation Technology and Traffic Engineering Vibration, Dynamical Systems, Control Applications of Nonlinear Dynamics and Chaos Theory Appl.Mathematics/Computational Methods of Engineering Ingenieurwissenschaften Gleisanlage Schnellfahrstrecke |
| url | https://doi.org/10.1007/978-981-10-2039-1 http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=029271989&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT leixiaoyan highspeedrailwaytrackdynamicsmodelsalgorithmsandapplications |