Energy efficient technologies for sustainability: selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India
Saved in:
Corporate Author: | |
---|---|
Other Authors: | , , |
Format: | Electronic eBook |
Language: | English |
Published: |
Durnten-Zurich
Trans Tech Publications
[2013]
|
Series: | Advanced materials research
768 |
Subjects: | |
Online Access: | FAW01 FAW02 |
Item Description: | Online resource; title from PDF title page (ebrary, viewed November 4, 2013) |
Physical Description: | 1 online resource (424 pages) illustrations (some color) |
ISBN: | 9783038261636 3038261637 9783037857823 303785782X |
Staff View
MARC
LEADER | 00000nmm a2200000zcb4500 | ||
---|---|---|---|
001 | BV043779928 | ||
003 | DE-604 | ||
005 | 20180130 | ||
006 | a |||| 10||| | ||
007 | cr|uuu---uuuuu | ||
008 | 160920s2013 |||| o||u| ||||||eng d | ||
020 | |a 9783038261636 |9 978-3-03826-163-6 | ||
020 | |a 3038261637 |9 3-03826-163-7 | ||
020 | |a 9783037857823 |9 978-3-03785-782-3 | ||
020 | |a 303785782X |9 3-03785-782-X | ||
035 | |a (ZDB-4-EBA)ocn868960843 | ||
035 | |a (OCoLC)868960843 | ||
035 | |a (DE-599)BVBBV043779928 | ||
040 | |a DE-604 |b ger |e rda | ||
041 | 0 | |a eng | |
049 | |a DE-1046 |a DE-1047 | ||
082 | 0 | |a 621.042 |2 23 | |
110 | 2 | |a International Conference on Energy Efficient Technologies for Sustainability <2013, Tamil Nadu, India> |e Verfasser |4 aut | |
245 | 1 | 0 | |a Energy efficient technologies for sustainability |b selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India |c edited by R. Edwin Raj, S. Joseph Sekhar and B.S.S. Daniel |
264 | 1 | |a Durnten-Zurich |b Trans Tech Publications |c [2013] | |
264 | 4 | |c © 2013 | |
300 | |a 1 online resource (424 pages) |b illustrations (some color) | ||
336 | |b txt |2 rdacontent | ||
337 | |b c |2 rdamedia | ||
338 | |b cr |2 rdacarrier | ||
490 | 1 | |a Advanced materials research |v v. 768 | |
500 | |a Online resource; title from PDF title page (ebrary, viewed November 4, 2013) | ||
505 | 8 | |a Ch. 1 Utilization of Alternate Energy for Sustainability -- Analysis of Three Port Full Bridge and Half Bridge DC-DC Converter Interfacing Renewable Energy System / R. Ramaprabha -- Comparative Analysis of Solution Methods to Power Electronic Interface Modeling for Renewable Energy Applications / D.P. Kothari -- Investigation of PMSG Fed Diode-Clamped Multilevel Inverter for Wind Energy System / R. Seyezhai -- Modeling of Photovoltaic Array and Simulation of MPPT Algorithm / R. Ramprakash -- A Review of Mathematical Models for Performance Analysis of Hybrid Solar Photovoltaic -- Thermal (PV/T) Air Heating Systems / G. Edison -- Structural Analysis of a Wind Turbine Blade / S. Prakash -- Application of Particle Swarm Optimization Technique for the Design of Maximum Power Point Tracking / N. Rajasekar | |
505 | 8 | |a Application of Wind Energy Source to Large Scale Desalination System Prefeasibility Analysis-Investigation of Wind Power Potential in Coastal Areas of Tamilnadu / V. Rajini -- Performance Analysis of Flat Plate Solar Water Heater by Changing the Heat Pipe Material / S. Balakrishnan -- Effect of Working Pressure on Structural, Electrical and Optical Properties of CIGS Thin Film Deposited by PLD / R. Chandra -- Modelling and Simulation of 3-phase Transformerless Split Inductor Multilevel Inverter for Grid Connected Photovoltaic System / S.S. Dash -- Implementation of a Low Cost Resonant Boost Converter Connected Photo Voltaic System / R. Boga -- Three Phase Hybrid 7-Level Inverter with 60 Degree PWM Scheme for PV Applications / V. Velmurugan -- Performance Studies on Solar Photovoltaic Thermal System for Crop Drying / K. Shekar -- Development of Computational Technique for Better Utilization of Renewable Energy / R. Arulmozhiyal | |
505 | 8 | |a Influence of Source -- Substrate Distance of Cu4SnS4 Thin Films Grown by Co-Evaporation / K.T.R. Reddy -- Simulation and Hardware and Implementation of Directly Coupled Four Phase Interleaved Boost Converter for Fuel Cells / R. Seyezhai -- Development and Field Test Performance of a Non-Conventional Unidirectional Co-Axial Two Series Rotors Micro Wind Turbine / S.N. Sapali -- Maximum Power Point Tracking Based on Look Up Table Approach / R. Ramaprabha -- Sensorless Control of PMSG Wind Turbine Using ANFIS / G. Muruganandam -- Design and Modeling of Photovoltaic System Fed Brushless DC Motor / R. Muthu -- Cost Effective Wind Energy Conversion Scheme Using Self-Excited Induction Generator / S.P. Sabberwal -- Performance Evaluation and Exhaust Emission Analysis of a CI Engine Fuelled with Pongamia Pinnata Biodiesel and its Blends / N. Bose | |
505 | 8 | |a Experimental Analysis of Energy Recovery from an Internal Combustion Engine Exhaust Using Rankine Cycle / P. Seenikannan -- Experimental Investigation of Nano Particles Blended with Water on Solar Flat Plate Collector / R. Balamurugan -- ch. 2 Energy Efficient Automotive Technologies -- Spray Characteristics of Diesel and Biodiesel in Direct Injection Diesel Engine / N. Nallusamy -- Experimental Study on the Spray Characteristics of Diesel and Biodiesel (Jatropha Oil) in a Spray Chamber / N. Nallusamy -- Effect of DEE Injection in Pongamia Pinnata Biodiesel Fulled CI Engine Using Hydrogen as Secondary Fuel / U.P. Vignesh -- Development of Energy Saving and Environment Friendly Aluminum Hybrid Composite Materials for Vehicle Applications / S.S.I. Faiyaz -- Performance Improvement on a Single Cylinder Diesel Engine Powered with Pongamia Biodiesel by Incorporating Swirling Grooves / K. Annamalai | |
505 | 8 | |a Influence of Dual Fuel Twin Injection on Diesel Engine Combustion and Emission Characteristics / R.T.K. Raj -- Mechanical Modifications to Convert Small Two Strokes Carbureted Engine to Electronic Fuel Injection System Engine to Reduce Emission and Fuel Consumption / A.N. Tikekar -- Comparison of Performance and Emission Characteristic of Tamanu, Mahua and Pongamia Biodiesel in a Di Diesel Engine / K. Annamalai -- Numerical Investigations of Spray Droplet Parameters in a Direct Injection Diesel Engine Using 3-Z Extended Coherent Flame Model / R.T.K. Raj -- Analysis and Experimentation of a Three Phase Asymmetric Cascaded Multilevel Inverter for Electric Vehicles / V. Vardhaman -- Investigations on the Effect of Bio Fuel Enhancer Additive with Cashew Nut Shell Liquid Biodiesel Blends on Engine Performance and Pollutant Emissions in a Diesel Engine / S. Ramabalan | |
505 | 8 | |a Performance and Emission Characteristics of Low Heat Rejection Diesel Engine Fuelled with Rice Bran Oil Biodiesel / C. Dhanesh -- Effects of Compression Ratio on Performance and Emission of Internal Combustion Engine with Used Vegetable Oil Methyl Easter / N. Nedunchezhian -- Experimental Studies on Performance and Emission Analysis in Diesel Engine Using Bio-Fuel (Neem Oil) / P. Seenikannan -- ch. 3 Energy Efficient Manufacturing Systems -- Outlook of Indian Household Energy and Emission Profile / S.K. Yawale -- Estimation of Energy and Carbon Saving Potential in Industrial Lighting System / D. Devaraj -- Comparison Studies on Microwave & Muffle Furnace Heat Treatment for Al-B4C Composite / A. Padmanathan -- ch. 4 Improving the Efficiency of Power Systems -- Comparison of Constant Instantaneous Power Control & Synchronous Rotating Frame Strategy for Total Harmonic Reduction in Aircraft System (400Hz) / V.M. Mishra | |
505 | 8 | |a Uncertainty Modelled Power Flow Analysis for DG Sourced Power Systems / D. Poornima -- Mitigation of Power Quality Problems Using DSTATCOM with Reduced DC Link Voltage / S.S. Dash -- Nonlinear Unbalanced Load Compensation for PV Sourced Grid Connected Inverter / M. Jeevitha -- Analysis and Stability Enhancement of DG Sourced Power System with Modified AVR and PSS / C. Birindha -- Harmonic and Power Factor Analysis with Reactor and Capacitor in Adjustable Speed Drive / R. Suganthi -- Optimization Techniques for the Economic Dispatch Problem in Various Generation Plant / A. Allirani -- Mitigation of Power Quality Issues by Adaptive Current Hysteresis Band Controller Based Shunt Active Filter / R. Abirami -- Synthesis and Characterization of PANI/Ferric Chloride Composite for Fabrication of Electrodes in Supercapacitor / M. Govindasamy -- Mitigation of Voltage Sags and Swells by Dynamic Voltage Restorer / D. Devaraj | |
505 | 8 | |a A Novel Control Strategy for DVR to Improve Voltage Profile in Wind Farm / P.C. Babu -- Reliability Improvement in a Radial Distribution System Using DG / M. Sudhakaran -- Speed Control of Induction Motor via Pic Controller Using Lab View / R. Arulmozhiyal -- Optimum Allocation of Distributed Generation Based on Nodal Pricing for Profit and Social Welfare Maximization / S.S. Dash -- Maximum Loss Reduction and Voltage Profile Improvement with Placement of Hybrid Solar-Wind System / M. Sudhakaran -- Transient Stability Improvement with Unified Power Flow Controller Using Fuzzy Logic and ANFIS Approach / C.K. Rani -- Analysis of Full Bridge Series Parallel Resonant Converter for Battery Chargers / S.S. Dash -- Stability Improvement in Power Systems Using Unified Power Flow Controller (UPFC) / J. Michael -- Three Input DC-DC Boost Converter for Hybrid Power System with Multilevel Inverter / R.J. Uthayakumar -- Design and Simulation of Energy Efficient Fixed Frequency Pulse Controlled Power Converter for Induction Melting Application / M. Beryl | |
505 | 8 | |a Energy is the major driving force for the economy of any nation. The challenge for continuous generation of power to meet the ever growing demand is a daunting task, especially due to limited resources. This collection of peer reviewed papers contains original research articles in different areas of energy efficient technologies such as: Alternate Energy, Building Technologies, Automotive Technologies, Modeling and Design, Manufacturing Systems and Power Systems. We hope that the novel ideas presented in these papers will trigger more application oriented research in relation with latest technology to conserve and sustain energy. Drawn from papers presented at the international conference on Energy Efficient Technologies for Sustainability in April 2013 at St. Xavier's Catholic College of Engineering in India, these address alternate energy, building technologies, automotive technology, modeling and design, manufacturing systems, and power systems. Other topics include a three-port full bridge and half bridge renewable energy system, a solution method to power electronic interface modeling, a photovoltaic array, models for performance analysis of hybrid voltaic thermal air heating systems, spray characteristics of diesel and biodiesel in a direct injection diesel engine, environmentally friendly aluminum hybrid materials, emission analysis in a diesel engine using biofuel, energy and carbon saving potential in industrial lighting systems, harmony and power factor analysis with a reactor and a capacitor in an adjustable speed drive | |
650 | 7 | |a TECHNOLOGY & ENGINEERING / Mechanical |2 bisacsh | |
650 | 7 | |a Energy conservation |2 fast | |
650 | 7 | |a Renewable energy sources |2 fast | |
650 | 4 | |a Energy conservation |v Congresses |a Renewable energy sources |v Congresses | |
655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |2 gnd-content | |
700 | 1 | |a Raj, R. Edwin |4 edt | |
700 | 1 | |a Sekhar, S. Joseph |4 edt | |
700 | 1 | |a Daniel, B. S. S. |4 edt | |
830 | 0 | |a Advanced materials research |v 768 |w (DE-604)BV035441301 |9 768 | |
912 | |a ZDB-4-EBA | ||
999 | |a oai:aleph.bib-bvb.de:BVB01-029190988 | ||
966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=646138 |l FAW01 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=646138 |l FAW02 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext |
Record in the Search Index
_version_ | 1804176609247232000 |
---|---|
any_adam_object | |
author2 | Raj, R. Edwin Sekhar, S. Joseph Daniel, B. S. S. |
author2_role | edt edt edt |
author2_variant | r e r re rer s j s sj sjs b s s d bss bssd |
author_corporate | International Conference on Energy Efficient Technologies for Sustainability <2013, Tamil Nadu, India> |
author_corporate_role | aut |
author_facet | Raj, R. Edwin Sekhar, S. Joseph Daniel, B. S. S. International Conference on Energy Efficient Technologies for Sustainability <2013, Tamil Nadu, India> |
author_sort | International Conference on Energy Efficient Technologies for Sustainability <2013, Tamil Nadu, India> |
building | Verbundindex |
bvnumber | BV043779928 |
collection | ZDB-4-EBA |
contents | Ch. 1 Utilization of Alternate Energy for Sustainability -- Analysis of Three Port Full Bridge and Half Bridge DC-DC Converter Interfacing Renewable Energy System / R. Ramaprabha -- Comparative Analysis of Solution Methods to Power Electronic Interface Modeling for Renewable Energy Applications / D.P. Kothari -- Investigation of PMSG Fed Diode-Clamped Multilevel Inverter for Wind Energy System / R. Seyezhai -- Modeling of Photovoltaic Array and Simulation of MPPT Algorithm / R. Ramprakash -- A Review of Mathematical Models for Performance Analysis of Hybrid Solar Photovoltaic -- Thermal (PV/T) Air Heating Systems / G. Edison -- Structural Analysis of a Wind Turbine Blade / S. Prakash -- Application of Particle Swarm Optimization Technique for the Design of Maximum Power Point Tracking / N. Rajasekar Application of Wind Energy Source to Large Scale Desalination System Prefeasibility Analysis-Investigation of Wind Power Potential in Coastal Areas of Tamilnadu / V. Rajini -- Performance Analysis of Flat Plate Solar Water Heater by Changing the Heat Pipe Material / S. Balakrishnan -- Effect of Working Pressure on Structural, Electrical and Optical Properties of CIGS Thin Film Deposited by PLD / R. Chandra -- Modelling and Simulation of 3-phase Transformerless Split Inductor Multilevel Inverter for Grid Connected Photovoltaic System / S.S. Dash -- Implementation of a Low Cost Resonant Boost Converter Connected Photo Voltaic System / R. Boga -- Three Phase Hybrid 7-Level Inverter with 60 Degree PWM Scheme for PV Applications / V. Velmurugan -- Performance Studies on Solar Photovoltaic Thermal System for Crop Drying / K. Shekar -- Development of Computational Technique for Better Utilization of Renewable Energy / R. Arulmozhiyal Influence of Source -- Substrate Distance of Cu4SnS4 Thin Films Grown by Co-Evaporation / K.T.R. Reddy -- Simulation and Hardware and Implementation of Directly Coupled Four Phase Interleaved Boost Converter for Fuel Cells / R. Seyezhai -- Development and Field Test Performance of a Non-Conventional Unidirectional Co-Axial Two Series Rotors Micro Wind Turbine / S.N. Sapali -- Maximum Power Point Tracking Based on Look Up Table Approach / R. Ramaprabha -- Sensorless Control of PMSG Wind Turbine Using ANFIS / G. Muruganandam -- Design and Modeling of Photovoltaic System Fed Brushless DC Motor / R. Muthu -- Cost Effective Wind Energy Conversion Scheme Using Self-Excited Induction Generator / S.P. Sabberwal -- Performance Evaluation and Exhaust Emission Analysis of a CI Engine Fuelled with Pongamia Pinnata Biodiesel and its Blends / N. Bose Experimental Analysis of Energy Recovery from an Internal Combustion Engine Exhaust Using Rankine Cycle / P. Seenikannan -- Experimental Investigation of Nano Particles Blended with Water on Solar Flat Plate Collector / R. Balamurugan -- ch. 2 Energy Efficient Automotive Technologies -- Spray Characteristics of Diesel and Biodiesel in Direct Injection Diesel Engine / N. Nallusamy -- Experimental Study on the Spray Characteristics of Diesel and Biodiesel (Jatropha Oil) in a Spray Chamber / N. Nallusamy -- Effect of DEE Injection in Pongamia Pinnata Biodiesel Fulled CI Engine Using Hydrogen as Secondary Fuel / U.P. Vignesh -- Development of Energy Saving and Environment Friendly Aluminum Hybrid Composite Materials for Vehicle Applications / S.S.I. Faiyaz -- Performance Improvement on a Single Cylinder Diesel Engine Powered with Pongamia Biodiesel by Incorporating Swirling Grooves / K. Annamalai Influence of Dual Fuel Twin Injection on Diesel Engine Combustion and Emission Characteristics / R.T.K. Raj -- Mechanical Modifications to Convert Small Two Strokes Carbureted Engine to Electronic Fuel Injection System Engine to Reduce Emission and Fuel Consumption / A.N. Tikekar -- Comparison of Performance and Emission Characteristic of Tamanu, Mahua and Pongamia Biodiesel in a Di Diesel Engine / K. Annamalai -- Numerical Investigations of Spray Droplet Parameters in a Direct Injection Diesel Engine Using 3-Z Extended Coherent Flame Model / R.T.K. Raj -- Analysis and Experimentation of a Three Phase Asymmetric Cascaded Multilevel Inverter for Electric Vehicles / V. Vardhaman -- Investigations on the Effect of Bio Fuel Enhancer Additive with Cashew Nut Shell Liquid Biodiesel Blends on Engine Performance and Pollutant Emissions in a Diesel Engine / S. Ramabalan Performance and Emission Characteristics of Low Heat Rejection Diesel Engine Fuelled with Rice Bran Oil Biodiesel / C. Dhanesh -- Effects of Compression Ratio on Performance and Emission of Internal Combustion Engine with Used Vegetable Oil Methyl Easter / N. Nedunchezhian -- Experimental Studies on Performance and Emission Analysis in Diesel Engine Using Bio-Fuel (Neem Oil) / P. Seenikannan -- ch. 3 Energy Efficient Manufacturing Systems -- Outlook of Indian Household Energy and Emission Profile / S.K. Yawale -- Estimation of Energy and Carbon Saving Potential in Industrial Lighting System / D. Devaraj -- Comparison Studies on Microwave & Muffle Furnace Heat Treatment for Al-B4C Composite / A. Padmanathan -- ch. 4 Improving the Efficiency of Power Systems -- Comparison of Constant Instantaneous Power Control & Synchronous Rotating Frame Strategy for Total Harmonic Reduction in Aircraft System (400Hz) / V.M. Mishra Uncertainty Modelled Power Flow Analysis for DG Sourced Power Systems / D. Poornima -- Mitigation of Power Quality Problems Using DSTATCOM with Reduced DC Link Voltage / S.S. Dash -- Nonlinear Unbalanced Load Compensation for PV Sourced Grid Connected Inverter / M. Jeevitha -- Analysis and Stability Enhancement of DG Sourced Power System with Modified AVR and PSS / C. Birindha -- Harmonic and Power Factor Analysis with Reactor and Capacitor in Adjustable Speed Drive / R. Suganthi -- Optimization Techniques for the Economic Dispatch Problem in Various Generation Plant / A. Allirani -- Mitigation of Power Quality Issues by Adaptive Current Hysteresis Band Controller Based Shunt Active Filter / R. Abirami -- Synthesis and Characterization of PANI/Ferric Chloride Composite for Fabrication of Electrodes in Supercapacitor / M. Govindasamy -- Mitigation of Voltage Sags and Swells by Dynamic Voltage Restorer / D. Devaraj A Novel Control Strategy for DVR to Improve Voltage Profile in Wind Farm / P.C. Babu -- Reliability Improvement in a Radial Distribution System Using DG / M. Sudhakaran -- Speed Control of Induction Motor via Pic Controller Using Lab View / R. Arulmozhiyal -- Optimum Allocation of Distributed Generation Based on Nodal Pricing for Profit and Social Welfare Maximization / S.S. Dash -- Maximum Loss Reduction and Voltage Profile Improvement with Placement of Hybrid Solar-Wind System / M. Sudhakaran -- Transient Stability Improvement with Unified Power Flow Controller Using Fuzzy Logic and ANFIS Approach / C.K. Rani -- Analysis of Full Bridge Series Parallel Resonant Converter for Battery Chargers / S.S. Dash -- Stability Improvement in Power Systems Using Unified Power Flow Controller (UPFC) / J. Michael -- Three Input DC-DC Boost Converter for Hybrid Power System with Multilevel Inverter / R.J. Uthayakumar -- Design and Simulation of Energy Efficient Fixed Frequency Pulse Controlled Power Converter for Induction Melting Application / M. Beryl Energy is the major driving force for the economy of any nation. The challenge for continuous generation of power to meet the ever growing demand is a daunting task, especially due to limited resources. This collection of peer reviewed papers contains original research articles in different areas of energy efficient technologies such as: Alternate Energy, Building Technologies, Automotive Technologies, Modeling and Design, Manufacturing Systems and Power Systems. We hope that the novel ideas presented in these papers will trigger more application oriented research in relation with latest technology to conserve and sustain energy. Drawn from papers presented at the international conference on Energy Efficient Technologies for Sustainability in April 2013 at St. Xavier's Catholic College of Engineering in India, these address alternate energy, building technologies, automotive technology, modeling and design, manufacturing systems, and power systems. Other topics include a three-port full bridge and half bridge renewable energy system, a solution method to power electronic interface modeling, a photovoltaic array, models for performance analysis of hybrid voltaic thermal air heating systems, spray characteristics of diesel and biodiesel in a direct injection diesel engine, environmentally friendly aluminum hybrid materials, emission analysis in a diesel engine using biofuel, energy and carbon saving potential in industrial lighting systems, harmony and power factor analysis with a reactor and a capacitor in an adjustable speed drive |
ctrlnum | (ZDB-4-EBA)ocn868960843 (OCoLC)868960843 (DE-599)BVBBV043779928 |
dewey-full | 621.042 |
dewey-hundreds | 600 - Technology (Applied sciences) |
dewey-ones | 621 - Applied physics |
dewey-raw | 621.042 |
dewey-search | 621.042 |
dewey-sort | 3621.042 |
dewey-tens | 620 - Engineering and allied operations |
discipline | Energietechnik |
format | Electronic eBook |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>11309nmm a2200613zcb4500</leader><controlfield tag="001">BV043779928</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20180130 </controlfield><controlfield tag="006">a |||| 10||| </controlfield><controlfield tag="007">cr|uuu---uuuuu</controlfield><controlfield tag="008">160920s2013 |||| o||u| ||||||eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038261636</subfield><subfield code="9">978-3-03826-163-6</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038261637</subfield><subfield code="9">3-03826-163-7</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783037857823</subfield><subfield code="9">978-3-03785-782-3</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">303785782X</subfield><subfield code="9">3-03785-782-X</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ZDB-4-EBA)ocn868960843</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)868960843</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043779928</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-1046</subfield><subfield code="a">DE-1047</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">621.042</subfield><subfield code="2">23</subfield></datafield><datafield tag="110" ind1="2" ind2=" "><subfield code="a">International Conference on Energy Efficient Technologies for Sustainability <2013, Tamil Nadu, India></subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Energy efficient technologies for sustainability</subfield><subfield code="b">selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India</subfield><subfield code="c">edited by R. Edwin Raj, S. Joseph Sekhar and B.S.S. Daniel</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Durnten-Zurich</subfield><subfield code="b">Trans Tech Publications</subfield><subfield code="c">[2013]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">© 2013</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (424 pages)</subfield><subfield code="b">illustrations (some color)</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Advanced materials research</subfield><subfield code="v">v. 768</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Online resource; title from PDF title page (ebrary, viewed November 4, 2013)</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Ch. 1 Utilization of Alternate Energy for Sustainability -- Analysis of Three Port Full Bridge and Half Bridge DC-DC Converter Interfacing Renewable Energy System / R. Ramaprabha -- Comparative Analysis of Solution Methods to Power Electronic Interface Modeling for Renewable Energy Applications / D.P. Kothari -- Investigation of PMSG Fed Diode-Clamped Multilevel Inverter for Wind Energy System / R. Seyezhai -- Modeling of Photovoltaic Array and Simulation of MPPT Algorithm / R. Ramprakash -- A Review of Mathematical Models for Performance Analysis of Hybrid Solar Photovoltaic -- Thermal (PV/T) Air Heating Systems / G. Edison -- Structural Analysis of a Wind Turbine Blade / S. Prakash -- Application of Particle Swarm Optimization Technique for the Design of Maximum Power Point Tracking / N. Rajasekar</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Application of Wind Energy Source to Large Scale Desalination System Prefeasibility Analysis-Investigation of Wind Power Potential in Coastal Areas of Tamilnadu / V. Rajini -- Performance Analysis of Flat Plate Solar Water Heater by Changing the Heat Pipe Material / S. Balakrishnan -- Effect of Working Pressure on Structural, Electrical and Optical Properties of CIGS Thin Film Deposited by PLD / R. Chandra -- Modelling and Simulation of 3-phase Transformerless Split Inductor Multilevel Inverter for Grid Connected Photovoltaic System / S.S. Dash -- Implementation of a Low Cost Resonant Boost Converter Connected Photo Voltaic System / R. Boga -- Three Phase Hybrid 7-Level Inverter with 60 Degree PWM Scheme for PV Applications / V. Velmurugan -- Performance Studies on Solar Photovoltaic Thermal System for Crop Drying / K. Shekar -- Development of Computational Technique for Better Utilization of Renewable Energy / R. Arulmozhiyal</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Influence of Source -- Substrate Distance of Cu4SnS4 Thin Films Grown by Co-Evaporation / K.T.R. Reddy -- Simulation and Hardware and Implementation of Directly Coupled Four Phase Interleaved Boost Converter for Fuel Cells / R. Seyezhai -- Development and Field Test Performance of a Non-Conventional Unidirectional Co-Axial Two Series Rotors Micro Wind Turbine / S.N. Sapali -- Maximum Power Point Tracking Based on Look Up Table Approach / R. Ramaprabha -- Sensorless Control of PMSG Wind Turbine Using ANFIS / G. Muruganandam -- Design and Modeling of Photovoltaic System Fed Brushless DC Motor / R. Muthu -- Cost Effective Wind Energy Conversion Scheme Using Self-Excited Induction Generator / S.P. Sabberwal -- Performance Evaluation and Exhaust Emission Analysis of a CI Engine Fuelled with Pongamia Pinnata Biodiesel and its Blends / N. Bose</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Experimental Analysis of Energy Recovery from an Internal Combustion Engine Exhaust Using Rankine Cycle / P. Seenikannan -- Experimental Investigation of Nano Particles Blended with Water on Solar Flat Plate Collector / R. Balamurugan -- ch. 2 Energy Efficient Automotive Technologies -- Spray Characteristics of Diesel and Biodiesel in Direct Injection Diesel Engine / N. Nallusamy -- Experimental Study on the Spray Characteristics of Diesel and Biodiesel (Jatropha Oil) in a Spray Chamber / N. Nallusamy -- Effect of DEE Injection in Pongamia Pinnata Biodiesel Fulled CI Engine Using Hydrogen as Secondary Fuel / U.P. Vignesh -- Development of Energy Saving and Environment Friendly Aluminum Hybrid Composite Materials for Vehicle Applications / S.S.I. Faiyaz -- Performance Improvement on a Single Cylinder Diesel Engine Powered with Pongamia Biodiesel by Incorporating Swirling Grooves / K. Annamalai</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Influence of Dual Fuel Twin Injection on Diesel Engine Combustion and Emission Characteristics / R.T.K. Raj -- Mechanical Modifications to Convert Small Two Strokes Carbureted Engine to Electronic Fuel Injection System Engine to Reduce Emission and Fuel Consumption / A.N. Tikekar -- Comparison of Performance and Emission Characteristic of Tamanu, Mahua and Pongamia Biodiesel in a Di Diesel Engine / K. Annamalai -- Numerical Investigations of Spray Droplet Parameters in a Direct Injection Diesel Engine Using 3-Z Extended Coherent Flame Model / R.T.K. Raj -- Analysis and Experimentation of a Three Phase Asymmetric Cascaded Multilevel Inverter for Electric Vehicles / V. Vardhaman -- Investigations on the Effect of Bio Fuel Enhancer Additive with Cashew Nut Shell Liquid Biodiesel Blends on Engine Performance and Pollutant Emissions in a Diesel Engine / S. Ramabalan</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Performance and Emission Characteristics of Low Heat Rejection Diesel Engine Fuelled with Rice Bran Oil Biodiesel / C. Dhanesh -- Effects of Compression Ratio on Performance and Emission of Internal Combustion Engine with Used Vegetable Oil Methyl Easter / N. Nedunchezhian -- Experimental Studies on Performance and Emission Analysis in Diesel Engine Using Bio-Fuel (Neem Oil) / P. Seenikannan -- ch. 3 Energy Efficient Manufacturing Systems -- Outlook of Indian Household Energy and Emission Profile / S.K. Yawale -- Estimation of Energy and Carbon Saving Potential in Industrial Lighting System / D. Devaraj -- Comparison Studies on Microwave & Muffle Furnace Heat Treatment for Al-B4C Composite / A. Padmanathan -- ch. 4 Improving the Efficiency of Power Systems -- Comparison of Constant Instantaneous Power Control & Synchronous Rotating Frame Strategy for Total Harmonic Reduction in Aircraft System (400Hz) / V.M. Mishra</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Uncertainty Modelled Power Flow Analysis for DG Sourced Power Systems / D. Poornima -- Mitigation of Power Quality Problems Using DSTATCOM with Reduced DC Link Voltage / S.S. Dash -- Nonlinear Unbalanced Load Compensation for PV Sourced Grid Connected Inverter / M. Jeevitha -- Analysis and Stability Enhancement of DG Sourced Power System with Modified AVR and PSS / C. Birindha -- Harmonic and Power Factor Analysis with Reactor and Capacitor in Adjustable Speed Drive / R. Suganthi -- Optimization Techniques for the Economic Dispatch Problem in Various Generation Plant / A. Allirani -- Mitigation of Power Quality Issues by Adaptive Current Hysteresis Band Controller Based Shunt Active Filter / R. Abirami -- Synthesis and Characterization of PANI/Ferric Chloride Composite for Fabrication of Electrodes in Supercapacitor / M. Govindasamy -- Mitigation of Voltage Sags and Swells by Dynamic Voltage Restorer / D. Devaraj</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">A Novel Control Strategy for DVR to Improve Voltage Profile in Wind Farm / P.C. Babu -- Reliability Improvement in a Radial Distribution System Using DG / M. Sudhakaran -- Speed Control of Induction Motor via Pic Controller Using Lab View / R. Arulmozhiyal -- Optimum Allocation of Distributed Generation Based on Nodal Pricing for Profit and Social Welfare Maximization / S.S. Dash -- Maximum Loss Reduction and Voltage Profile Improvement with Placement of Hybrid Solar-Wind System / M. Sudhakaran -- Transient Stability Improvement with Unified Power Flow Controller Using Fuzzy Logic and ANFIS Approach / C.K. Rani -- Analysis of Full Bridge Series Parallel Resonant Converter for Battery Chargers / S.S. Dash -- Stability Improvement in Power Systems Using Unified Power Flow Controller (UPFC) / J. Michael -- Three Input DC-DC Boost Converter for Hybrid Power System with Multilevel Inverter / R.J. Uthayakumar -- Design and Simulation of Energy Efficient Fixed Frequency Pulse Controlled Power Converter for Induction Melting Application / M. Beryl</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Energy is the major driving force for the economy of any nation. The challenge for continuous generation of power to meet the ever growing demand is a daunting task, especially due to limited resources. This collection of peer reviewed papers contains original research articles in different areas of energy efficient technologies such as: Alternate Energy, Building Technologies, Automotive Technologies, Modeling and Design, Manufacturing Systems and Power Systems. We hope that the novel ideas presented in these papers will trigger more application oriented research in relation with latest technology to conserve and sustain energy. Drawn from papers presented at the international conference on Energy Efficient Technologies for Sustainability in April 2013 at St. Xavier's Catholic College of Engineering in India, these address alternate energy, building technologies, automotive technology, modeling and design, manufacturing systems, and power systems. Other topics include a three-port full bridge and half bridge renewable energy system, a solution method to power electronic interface modeling, a photovoltaic array, models for performance analysis of hybrid voltaic thermal air heating systems, spray characteristics of diesel and biodiesel in a direct injection diesel engine, environmentally friendly aluminum hybrid materials, emission analysis in a diesel engine using biofuel, energy and carbon saving potential in industrial lighting systems, harmony and power factor analysis with a reactor and a capacitor in an adjustable speed drive</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING / Mechanical</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Energy conservation</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Renewable energy sources</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Energy conservation</subfield><subfield code="v">Congresses</subfield><subfield code="a">Renewable energy sources</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Raj, R. Edwin</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Sekhar, S. Joseph</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Daniel, B. S. S.</subfield><subfield code="4">edt</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Advanced materials research</subfield><subfield code="v">768</subfield><subfield code="w">(DE-604)BV035441301</subfield><subfield code="9">768</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029190988</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=646138</subfield><subfield code="l">FAW01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=646138</subfield><subfield code="l">FAW02</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield></record></collection> |
genre | (DE-588)1071861417 Konferenzschrift gnd-content |
genre_facet | Konferenzschrift |
id | DE-604.BV043779928 |
illustrated | Illustrated |
indexdate | 2024-07-10T07:34:54Z |
institution | BVB |
isbn | 9783038261636 3038261637 9783037857823 303785782X |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029190988 |
oclc_num | 868960843 |
open_access_boolean | |
owner | DE-1046 DE-1047 |
owner_facet | DE-1046 DE-1047 |
physical | 1 online resource (424 pages) illustrations (some color) |
psigel | ZDB-4-EBA ZDB-4-EBA FAW_PDA_EBA |
publishDate | 2013 |
publishDateSearch | 2013 |
publishDateSort | 2013 |
publisher | Trans Tech Publications |
record_format | marc |
series | Advanced materials research |
series2 | Advanced materials research |
spelling | International Conference on Energy Efficient Technologies for Sustainability <2013, Tamil Nadu, India> Verfasser aut Energy efficient technologies for sustainability selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India edited by R. Edwin Raj, S. Joseph Sekhar and B.S.S. Daniel Durnten-Zurich Trans Tech Publications [2013] © 2013 1 online resource (424 pages) illustrations (some color) txt rdacontent c rdamedia cr rdacarrier Advanced materials research v. 768 Online resource; title from PDF title page (ebrary, viewed November 4, 2013) Ch. 1 Utilization of Alternate Energy for Sustainability -- Analysis of Three Port Full Bridge and Half Bridge DC-DC Converter Interfacing Renewable Energy System / R. Ramaprabha -- Comparative Analysis of Solution Methods to Power Electronic Interface Modeling for Renewable Energy Applications / D.P. Kothari -- Investigation of PMSG Fed Diode-Clamped Multilevel Inverter for Wind Energy System / R. Seyezhai -- Modeling of Photovoltaic Array and Simulation of MPPT Algorithm / R. Ramprakash -- A Review of Mathematical Models for Performance Analysis of Hybrid Solar Photovoltaic -- Thermal (PV/T) Air Heating Systems / G. Edison -- Structural Analysis of a Wind Turbine Blade / S. Prakash -- Application of Particle Swarm Optimization Technique for the Design of Maximum Power Point Tracking / N. Rajasekar Application of Wind Energy Source to Large Scale Desalination System Prefeasibility Analysis-Investigation of Wind Power Potential in Coastal Areas of Tamilnadu / V. Rajini -- Performance Analysis of Flat Plate Solar Water Heater by Changing the Heat Pipe Material / S. Balakrishnan -- Effect of Working Pressure on Structural, Electrical and Optical Properties of CIGS Thin Film Deposited by PLD / R. Chandra -- Modelling and Simulation of 3-phase Transformerless Split Inductor Multilevel Inverter for Grid Connected Photovoltaic System / S.S. Dash -- Implementation of a Low Cost Resonant Boost Converter Connected Photo Voltaic System / R. Boga -- Three Phase Hybrid 7-Level Inverter with 60 Degree PWM Scheme for PV Applications / V. Velmurugan -- Performance Studies on Solar Photovoltaic Thermal System for Crop Drying / K. Shekar -- Development of Computational Technique for Better Utilization of Renewable Energy / R. Arulmozhiyal Influence of Source -- Substrate Distance of Cu4SnS4 Thin Films Grown by Co-Evaporation / K.T.R. Reddy -- Simulation and Hardware and Implementation of Directly Coupled Four Phase Interleaved Boost Converter for Fuel Cells / R. Seyezhai -- Development and Field Test Performance of a Non-Conventional Unidirectional Co-Axial Two Series Rotors Micro Wind Turbine / S.N. Sapali -- Maximum Power Point Tracking Based on Look Up Table Approach / R. Ramaprabha -- Sensorless Control of PMSG Wind Turbine Using ANFIS / G. Muruganandam -- Design and Modeling of Photovoltaic System Fed Brushless DC Motor / R. Muthu -- Cost Effective Wind Energy Conversion Scheme Using Self-Excited Induction Generator / S.P. Sabberwal -- Performance Evaluation and Exhaust Emission Analysis of a CI Engine Fuelled with Pongamia Pinnata Biodiesel and its Blends / N. Bose Experimental Analysis of Energy Recovery from an Internal Combustion Engine Exhaust Using Rankine Cycle / P. Seenikannan -- Experimental Investigation of Nano Particles Blended with Water on Solar Flat Plate Collector / R. Balamurugan -- ch. 2 Energy Efficient Automotive Technologies -- Spray Characteristics of Diesel and Biodiesel in Direct Injection Diesel Engine / N. Nallusamy -- Experimental Study on the Spray Characteristics of Diesel and Biodiesel (Jatropha Oil) in a Spray Chamber / N. Nallusamy -- Effect of DEE Injection in Pongamia Pinnata Biodiesel Fulled CI Engine Using Hydrogen as Secondary Fuel / U.P. Vignesh -- Development of Energy Saving and Environment Friendly Aluminum Hybrid Composite Materials for Vehicle Applications / S.S.I. Faiyaz -- Performance Improvement on a Single Cylinder Diesel Engine Powered with Pongamia Biodiesel by Incorporating Swirling Grooves / K. Annamalai Influence of Dual Fuel Twin Injection on Diesel Engine Combustion and Emission Characteristics / R.T.K. Raj -- Mechanical Modifications to Convert Small Two Strokes Carbureted Engine to Electronic Fuel Injection System Engine to Reduce Emission and Fuel Consumption / A.N. Tikekar -- Comparison of Performance and Emission Characteristic of Tamanu, Mahua and Pongamia Biodiesel in a Di Diesel Engine / K. Annamalai -- Numerical Investigations of Spray Droplet Parameters in a Direct Injection Diesel Engine Using 3-Z Extended Coherent Flame Model / R.T.K. Raj -- Analysis and Experimentation of a Three Phase Asymmetric Cascaded Multilevel Inverter for Electric Vehicles / V. Vardhaman -- Investigations on the Effect of Bio Fuel Enhancer Additive with Cashew Nut Shell Liquid Biodiesel Blends on Engine Performance and Pollutant Emissions in a Diesel Engine / S. Ramabalan Performance and Emission Characteristics of Low Heat Rejection Diesel Engine Fuelled with Rice Bran Oil Biodiesel / C. Dhanesh -- Effects of Compression Ratio on Performance and Emission of Internal Combustion Engine with Used Vegetable Oil Methyl Easter / N. Nedunchezhian -- Experimental Studies on Performance and Emission Analysis in Diesel Engine Using Bio-Fuel (Neem Oil) / P. Seenikannan -- ch. 3 Energy Efficient Manufacturing Systems -- Outlook of Indian Household Energy and Emission Profile / S.K. Yawale -- Estimation of Energy and Carbon Saving Potential in Industrial Lighting System / D. Devaraj -- Comparison Studies on Microwave & Muffle Furnace Heat Treatment for Al-B4C Composite / A. Padmanathan -- ch. 4 Improving the Efficiency of Power Systems -- Comparison of Constant Instantaneous Power Control & Synchronous Rotating Frame Strategy for Total Harmonic Reduction in Aircraft System (400Hz) / V.M. Mishra Uncertainty Modelled Power Flow Analysis for DG Sourced Power Systems / D. Poornima -- Mitigation of Power Quality Problems Using DSTATCOM with Reduced DC Link Voltage / S.S. Dash -- Nonlinear Unbalanced Load Compensation for PV Sourced Grid Connected Inverter / M. Jeevitha -- Analysis and Stability Enhancement of DG Sourced Power System with Modified AVR and PSS / C. Birindha -- Harmonic and Power Factor Analysis with Reactor and Capacitor in Adjustable Speed Drive / R. Suganthi -- Optimization Techniques for the Economic Dispatch Problem in Various Generation Plant / A. Allirani -- Mitigation of Power Quality Issues by Adaptive Current Hysteresis Band Controller Based Shunt Active Filter / R. Abirami -- Synthesis and Characterization of PANI/Ferric Chloride Composite for Fabrication of Electrodes in Supercapacitor / M. Govindasamy -- Mitigation of Voltage Sags and Swells by Dynamic Voltage Restorer / D. Devaraj A Novel Control Strategy for DVR to Improve Voltage Profile in Wind Farm / P.C. Babu -- Reliability Improvement in a Radial Distribution System Using DG / M. Sudhakaran -- Speed Control of Induction Motor via Pic Controller Using Lab View / R. Arulmozhiyal -- Optimum Allocation of Distributed Generation Based on Nodal Pricing for Profit and Social Welfare Maximization / S.S. Dash -- Maximum Loss Reduction and Voltage Profile Improvement with Placement of Hybrid Solar-Wind System / M. Sudhakaran -- Transient Stability Improvement with Unified Power Flow Controller Using Fuzzy Logic and ANFIS Approach / C.K. Rani -- Analysis of Full Bridge Series Parallel Resonant Converter for Battery Chargers / S.S. Dash -- Stability Improvement in Power Systems Using Unified Power Flow Controller (UPFC) / J. Michael -- Three Input DC-DC Boost Converter for Hybrid Power System with Multilevel Inverter / R.J. Uthayakumar -- Design and Simulation of Energy Efficient Fixed Frequency Pulse Controlled Power Converter for Induction Melting Application / M. Beryl Energy is the major driving force for the economy of any nation. The challenge for continuous generation of power to meet the ever growing demand is a daunting task, especially due to limited resources. This collection of peer reviewed papers contains original research articles in different areas of energy efficient technologies such as: Alternate Energy, Building Technologies, Automotive Technologies, Modeling and Design, Manufacturing Systems and Power Systems. We hope that the novel ideas presented in these papers will trigger more application oriented research in relation with latest technology to conserve and sustain energy. Drawn from papers presented at the international conference on Energy Efficient Technologies for Sustainability in April 2013 at St. Xavier's Catholic College of Engineering in India, these address alternate energy, building technologies, automotive technology, modeling and design, manufacturing systems, and power systems. Other topics include a three-port full bridge and half bridge renewable energy system, a solution method to power electronic interface modeling, a photovoltaic array, models for performance analysis of hybrid voltaic thermal air heating systems, spray characteristics of diesel and biodiesel in a direct injection diesel engine, environmentally friendly aluminum hybrid materials, emission analysis in a diesel engine using biofuel, energy and carbon saving potential in industrial lighting systems, harmony and power factor analysis with a reactor and a capacitor in an adjustable speed drive TECHNOLOGY & ENGINEERING / Mechanical bisacsh Energy conservation fast Renewable energy sources fast Energy conservation Congresses Renewable energy sources Congresses (DE-588)1071861417 Konferenzschrift gnd-content Raj, R. Edwin edt Sekhar, S. Joseph edt Daniel, B. S. S. edt Advanced materials research 768 (DE-604)BV035441301 768 |
spellingShingle | Energy efficient technologies for sustainability selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India Advanced materials research Ch. 1 Utilization of Alternate Energy for Sustainability -- Analysis of Three Port Full Bridge and Half Bridge DC-DC Converter Interfacing Renewable Energy System / R. Ramaprabha -- Comparative Analysis of Solution Methods to Power Electronic Interface Modeling for Renewable Energy Applications / D.P. Kothari -- Investigation of PMSG Fed Diode-Clamped Multilevel Inverter for Wind Energy System / R. Seyezhai -- Modeling of Photovoltaic Array and Simulation of MPPT Algorithm / R. Ramprakash -- A Review of Mathematical Models for Performance Analysis of Hybrid Solar Photovoltaic -- Thermal (PV/T) Air Heating Systems / G. Edison -- Structural Analysis of a Wind Turbine Blade / S. Prakash -- Application of Particle Swarm Optimization Technique for the Design of Maximum Power Point Tracking / N. Rajasekar Application of Wind Energy Source to Large Scale Desalination System Prefeasibility Analysis-Investigation of Wind Power Potential in Coastal Areas of Tamilnadu / V. Rajini -- Performance Analysis of Flat Plate Solar Water Heater by Changing the Heat Pipe Material / S. Balakrishnan -- Effect of Working Pressure on Structural, Electrical and Optical Properties of CIGS Thin Film Deposited by PLD / R. Chandra -- Modelling and Simulation of 3-phase Transformerless Split Inductor Multilevel Inverter for Grid Connected Photovoltaic System / S.S. Dash -- Implementation of a Low Cost Resonant Boost Converter Connected Photo Voltaic System / R. Boga -- Three Phase Hybrid 7-Level Inverter with 60 Degree PWM Scheme for PV Applications / V. Velmurugan -- Performance Studies on Solar Photovoltaic Thermal System for Crop Drying / K. Shekar -- Development of Computational Technique for Better Utilization of Renewable Energy / R. Arulmozhiyal Influence of Source -- Substrate Distance of Cu4SnS4 Thin Films Grown by Co-Evaporation / K.T.R. Reddy -- Simulation and Hardware and Implementation of Directly Coupled Four Phase Interleaved Boost Converter for Fuel Cells / R. Seyezhai -- Development and Field Test Performance of a Non-Conventional Unidirectional Co-Axial Two Series Rotors Micro Wind Turbine / S.N. Sapali -- Maximum Power Point Tracking Based on Look Up Table Approach / R. Ramaprabha -- Sensorless Control of PMSG Wind Turbine Using ANFIS / G. Muruganandam -- Design and Modeling of Photovoltaic System Fed Brushless DC Motor / R. Muthu -- Cost Effective Wind Energy Conversion Scheme Using Self-Excited Induction Generator / S.P. Sabberwal -- Performance Evaluation and Exhaust Emission Analysis of a CI Engine Fuelled with Pongamia Pinnata Biodiesel and its Blends / N. Bose Experimental Analysis of Energy Recovery from an Internal Combustion Engine Exhaust Using Rankine Cycle / P. Seenikannan -- Experimental Investigation of Nano Particles Blended with Water on Solar Flat Plate Collector / R. Balamurugan -- ch. 2 Energy Efficient Automotive Technologies -- Spray Characteristics of Diesel and Biodiesel in Direct Injection Diesel Engine / N. Nallusamy -- Experimental Study on the Spray Characteristics of Diesel and Biodiesel (Jatropha Oil) in a Spray Chamber / N. Nallusamy -- Effect of DEE Injection in Pongamia Pinnata Biodiesel Fulled CI Engine Using Hydrogen as Secondary Fuel / U.P. Vignesh -- Development of Energy Saving and Environment Friendly Aluminum Hybrid Composite Materials for Vehicle Applications / S.S.I. Faiyaz -- Performance Improvement on a Single Cylinder Diesel Engine Powered with Pongamia Biodiesel by Incorporating Swirling Grooves / K. Annamalai Influence of Dual Fuel Twin Injection on Diesel Engine Combustion and Emission Characteristics / R.T.K. Raj -- Mechanical Modifications to Convert Small Two Strokes Carbureted Engine to Electronic Fuel Injection System Engine to Reduce Emission and Fuel Consumption / A.N. Tikekar -- Comparison of Performance and Emission Characteristic of Tamanu, Mahua and Pongamia Biodiesel in a Di Diesel Engine / K. Annamalai -- Numerical Investigations of Spray Droplet Parameters in a Direct Injection Diesel Engine Using 3-Z Extended Coherent Flame Model / R.T.K. Raj -- Analysis and Experimentation of a Three Phase Asymmetric Cascaded Multilevel Inverter for Electric Vehicles / V. Vardhaman -- Investigations on the Effect of Bio Fuel Enhancer Additive with Cashew Nut Shell Liquid Biodiesel Blends on Engine Performance and Pollutant Emissions in a Diesel Engine / S. Ramabalan Performance and Emission Characteristics of Low Heat Rejection Diesel Engine Fuelled with Rice Bran Oil Biodiesel / C. Dhanesh -- Effects of Compression Ratio on Performance and Emission of Internal Combustion Engine with Used Vegetable Oil Methyl Easter / N. Nedunchezhian -- Experimental Studies on Performance and Emission Analysis in Diesel Engine Using Bio-Fuel (Neem Oil) / P. Seenikannan -- ch. 3 Energy Efficient Manufacturing Systems -- Outlook of Indian Household Energy and Emission Profile / S.K. Yawale -- Estimation of Energy and Carbon Saving Potential in Industrial Lighting System / D. Devaraj -- Comparison Studies on Microwave & Muffle Furnace Heat Treatment for Al-B4C Composite / A. Padmanathan -- ch. 4 Improving the Efficiency of Power Systems -- Comparison of Constant Instantaneous Power Control & Synchronous Rotating Frame Strategy for Total Harmonic Reduction in Aircraft System (400Hz) / V.M. Mishra Uncertainty Modelled Power Flow Analysis for DG Sourced Power Systems / D. Poornima -- Mitigation of Power Quality Problems Using DSTATCOM with Reduced DC Link Voltage / S.S. Dash -- Nonlinear Unbalanced Load Compensation for PV Sourced Grid Connected Inverter / M. Jeevitha -- Analysis and Stability Enhancement of DG Sourced Power System with Modified AVR and PSS / C. Birindha -- Harmonic and Power Factor Analysis with Reactor and Capacitor in Adjustable Speed Drive / R. Suganthi -- Optimization Techniques for the Economic Dispatch Problem in Various Generation Plant / A. Allirani -- Mitigation of Power Quality Issues by Adaptive Current Hysteresis Band Controller Based Shunt Active Filter / R. Abirami -- Synthesis and Characterization of PANI/Ferric Chloride Composite for Fabrication of Electrodes in Supercapacitor / M. Govindasamy -- Mitigation of Voltage Sags and Swells by Dynamic Voltage Restorer / D. Devaraj A Novel Control Strategy for DVR to Improve Voltage Profile in Wind Farm / P.C. Babu -- Reliability Improvement in a Radial Distribution System Using DG / M. Sudhakaran -- Speed Control of Induction Motor via Pic Controller Using Lab View / R. Arulmozhiyal -- Optimum Allocation of Distributed Generation Based on Nodal Pricing for Profit and Social Welfare Maximization / S.S. Dash -- Maximum Loss Reduction and Voltage Profile Improvement with Placement of Hybrid Solar-Wind System / M. Sudhakaran -- Transient Stability Improvement with Unified Power Flow Controller Using Fuzzy Logic and ANFIS Approach / C.K. Rani -- Analysis of Full Bridge Series Parallel Resonant Converter for Battery Chargers / S.S. Dash -- Stability Improvement in Power Systems Using Unified Power Flow Controller (UPFC) / J. Michael -- Three Input DC-DC Boost Converter for Hybrid Power System with Multilevel Inverter / R.J. Uthayakumar -- Design and Simulation of Energy Efficient Fixed Frequency Pulse Controlled Power Converter for Induction Melting Application / M. Beryl Energy is the major driving force for the economy of any nation. The challenge for continuous generation of power to meet the ever growing demand is a daunting task, especially due to limited resources. This collection of peer reviewed papers contains original research articles in different areas of energy efficient technologies such as: Alternate Energy, Building Technologies, Automotive Technologies, Modeling and Design, Manufacturing Systems and Power Systems. We hope that the novel ideas presented in these papers will trigger more application oriented research in relation with latest technology to conserve and sustain energy. Drawn from papers presented at the international conference on Energy Efficient Technologies for Sustainability in April 2013 at St. Xavier's Catholic College of Engineering in India, these address alternate energy, building technologies, automotive technology, modeling and design, manufacturing systems, and power systems. Other topics include a three-port full bridge and half bridge renewable energy system, a solution method to power electronic interface modeling, a photovoltaic array, models for performance analysis of hybrid voltaic thermal air heating systems, spray characteristics of diesel and biodiesel in a direct injection diesel engine, environmentally friendly aluminum hybrid materials, emission analysis in a diesel engine using biofuel, energy and carbon saving potential in industrial lighting systems, harmony and power factor analysis with a reactor and a capacitor in an adjustable speed drive TECHNOLOGY & ENGINEERING / Mechanical bisacsh Energy conservation fast Renewable energy sources fast Energy conservation Congresses Renewable energy sources Congresses |
subject_GND | (DE-588)1071861417 |
title | Energy efficient technologies for sustainability selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India |
title_auth | Energy efficient technologies for sustainability selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India |
title_exact_search | Energy efficient technologies for sustainability selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India |
title_full | Energy efficient technologies for sustainability selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India edited by R. Edwin Raj, S. Joseph Sekhar and B.S.S. Daniel |
title_fullStr | Energy efficient technologies for sustainability selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India edited by R. Edwin Raj, S. Joseph Sekhar and B.S.S. Daniel |
title_full_unstemmed | Energy efficient technologies for sustainability selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India edited by R. Edwin Raj, S. Joseph Sekhar and B.S.S. Daniel |
title_short | Energy efficient technologies for sustainability |
title_sort | energy efficient technologies for sustainability selected peer reviewed papers from the international conference on energy efficient technologies for sustainability iceets 2013 april 10 12 2013 tamilnadu india |
title_sub | selected, peer reviewed papers from the International Conference on Energy Efficient Technologies for Sustainability (ICEETS 2013), April 10-12, 2013, Tamilnadu, India |
topic | TECHNOLOGY & ENGINEERING / Mechanical bisacsh Energy conservation fast Renewable energy sources fast Energy conservation Congresses Renewable energy sources Congresses |
topic_facet | TECHNOLOGY & ENGINEERING / Mechanical Energy conservation Renewable energy sources Energy conservation Congresses Renewable energy sources Congresses Konferenzschrift |
volume_link | (DE-604)BV035441301 |
work_keys_str_mv | AT internationalconferenceonenergyefficienttechnologiesforsustainability2013tamilnaduindia energyefficienttechnologiesforsustainabilityselectedpeerreviewedpapersfromtheinternationalconferenceonenergyefficienttechnologiesforsustainabilityiceets2013april10122013tamilnaduindia AT rajredwin energyefficienttechnologiesforsustainabilityselectedpeerreviewedpapersfromtheinternationalconferenceonenergyefficienttechnologiesforsustainabilityiceets2013april10122013tamilnaduindia AT sekharsjoseph energyefficienttechnologiesforsustainabilityselectedpeerreviewedpapersfromtheinternationalconferenceonenergyefficienttechnologiesforsustainabilityiceets2013april10122013tamilnaduindia AT danielbss energyefficienttechnologiesforsustainabilityselectedpeerreviewedpapersfromtheinternationalconferenceonenergyefficienttechnologiesforsustainabilityiceets2013april10122013tamilnaduindia |