Materials processing technology: selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China
Saved in:
Corporate Author: | |
---|---|
Other Authors: | |
Format: | Electronic Conference Proceeding eBook |
Language: | English |
Published: |
Durnten, Switzerland
Trans Tech Publications
© 2011
|
Series: | Advanced materials research
337 |
Subjects: | |
Online Access: | FAW01 FAW02 |
Item Description: | Includes bibliographical references and indexes Materials Processing Technology, ICMPMT2011; Preface and Organizing Committees; Table of Contents; Chapter 1: Surface Engineering/Coatings; Mechanical Behaviours of Pumpkin Peel under Compression Test; Effect of Plasticizer of Sizing Agent on the Surface of Carbon Fibers and Interface of its Composites; Design of Gold Bead Chain Machine Based on Modern Design Methodology; Effect of Cold Reduction Ratio and Annealing Temperature on Microstructure and Mechanical Property of 240MPa Grade High Strength if Steel; Characterization of Micro-Arc Oxidation Coatings Formed on Biomedical Ni-Cr-Mo Alloy Study on TC4 Titanium Alloy by Laser Oxygen-Diffused Hardening Process under Different Gas AtmosphereNovel Functional Coating: Luminescent Coating; Mechanical Damping Properties of Silicone Rubber Prepared by Nano-SiO2 and AGE-Modified Polysiloxane Blends; Research on Key Technology of Ultra-High 3D Strengthening Heat Transfer in Plow Machining; Study on Properties of Electroless Ni-P Plating on 6063A Aluminum Alloy; Corrosion Resistance of Ni-CeO2 Nanocomposite Coating Prepared by Electrodeposition with Rotating Cathode in an Ultrasonic Field Effects of Two-Step DC Electrochemical Pretreatment of Fine Grinding WC-Co Tool Surface on Morphology and Quality of Diamond CoatingsResearch on Photoelectric Properties of Nanowires Doped DSSC; Design and Performance of the Transverse Rotating Magnetic Field Steered Arc Source Used in Vacuum Arc Deposition; Influence of Technological Parameter on Boehmite Sol Sealing Anodized Al 2024 Alloy; Fatigue Prediction for Pump End of High Pressure Fracturing Pump; Influence of Heat-Treatment on High-Phosphorus Ni-P Plating Coating Effects of Oxide Powders and Nanocrystalline Particles on the Sintering of Al2O3 Glass-CeramicsThe Relationship between Substrate Roughness and Wettability of Superhydrophobic Metal Carboxylate Surface; Review of Technology and Industry on Inorganic Non-Metallic Materials; Growth Characteristics, Microstructure and Corrosion Resistance of Micro-Arc Oxidation Coatings Fabricated on ZK60 Mg Alloy under Two Steps Voltage-Increasing Mode; Study on a Quinoline Inhibitor Used for Sulfur Corrosion on Carbon Steel: Properties Research and Field Test Effect of Phosphating Additives on Corrosion Resistance of Phosphate Coatings on AZ91D Magnesium AlloyFabrication and Characterization of Cellulose Acetate Ultrafine Fiber Containing Silver Nanoparticles by Electrospinning; The Optical Properties of DLC Films Processed by Laser Radiation; Study on CO2 Emission in the Process of Dealing with Vanadium-Titanium Magnetite; Ni-Induced Lateral Fast Crystallization of Amorphous Silicon Film by Microwave Annealing; Preparation and Performance of Zr(Ca)-Al-O-N Composites by Reaction Sintering of Al-ZrO2(Ca) in N2 Atmosphere This work's contents were subjected to strict peer-review by experts, and describe the latest advances and applications in the fields of surface engineering/coatings, modeling, analysis and simulation of manufacturing processes, materials forming/machining/joining, mechanical behavior and fracture, tooling testing and evaluation of materials. Review from Book News Inc.: Nearly 150 papers cover surface engineering/coatings; modeling, analyzing, and simulating manufacturing processes; materials forming/machining/joining; mechanical behavior and fracture; and tooling testing and evaluating materi |
Physical Description: | xviii, 805 pages |
ISBN: | 9783038136477 3038136476 9783037852477 303785247X |
Staff View
MARC
LEADER | 00000nmm a2200000zcb4500 | ||
---|---|---|---|
001 | BV043775813 | ||
003 | DE-604 | ||
005 | 20180206 | ||
006 | a |||| 10||| | ||
007 | cr|uuu---uuuuu | ||
008 | 160920s2011 |||| o||u| ||||||eng d | ||
020 | |a 9783038136477 |9 978-3-03813-647-7 | ||
020 | |a 3038136476 |9 3-03813-647-6 | ||
020 | |a 9783037852477 |9 978-3-03785-247-7 | ||
020 | |a 303785247X |9 3-03785-247-X | ||
035 | |a (ZDB-4-EBA)ocn838128414 | ||
035 | |a (OCoLC)838128414 | ||
035 | |a (DE-599)BVBBV043775813 | ||
040 | |a DE-604 |b ger |e aacr | ||
041 | 0 | |a eng | |
049 | |a DE-1046 |a DE-1047 | ||
082 | 0 | |a 670 |2 23 | |
111 | 2 | |a International Conference on Materials and Products Manufacturing Technology |n 1. |d 2011 |c Chengdu |j Verfasser |0 (DE-588)111728574X |4 aut | |
245 | 1 | 0 | |a Materials processing technology |b selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China |c edited by Prasad Yarlagadda [and others] |
246 | 1 | 3 | |a ICMPMT 2011 |
264 | 1 | |a Durnten, Switzerland |b Trans Tech Publications |c © 2011 | |
300 | |a xviii, 805 pages | ||
336 | |b txt |2 rdacontent | ||
337 | |b c |2 rdamedia | ||
338 | |b cr |2 rdacarrier | ||
490 | 1 | |a Advanced materials research |v v. 337 | |
500 | |a Includes bibliographical references and indexes | ||
500 | |a Materials Processing Technology, ICMPMT2011; Preface and Organizing Committees; Table of Contents; Chapter 1: Surface Engineering/Coatings; Mechanical Behaviours of Pumpkin Peel under Compression Test; Effect of Plasticizer of Sizing Agent on the Surface of Carbon Fibers and Interface of its Composites; Design of Gold Bead Chain Machine Based on Modern Design Methodology; Effect of Cold Reduction Ratio and Annealing Temperature on Microstructure and Mechanical Property of 240MPa Grade High Strength if Steel; Characterization of Micro-Arc Oxidation Coatings Formed on Biomedical Ni-Cr-Mo Alloy | ||
500 | |a Study on TC4 Titanium Alloy by Laser Oxygen-Diffused Hardening Process under Different Gas AtmosphereNovel Functional Coating: Luminescent Coating; Mechanical Damping Properties of Silicone Rubber Prepared by Nano-SiO2 and AGE-Modified Polysiloxane Blends; Research on Key Technology of Ultra-High 3D Strengthening Heat Transfer in Plow Machining; Study on Properties of Electroless Ni-P Plating on 6063A Aluminum Alloy; Corrosion Resistance of Ni-CeO2 Nanocomposite Coating Prepared by Electrodeposition with Rotating Cathode in an Ultrasonic Field | ||
500 | |a Effects of Two-Step DC Electrochemical Pretreatment of Fine Grinding WC-Co Tool Surface on Morphology and Quality of Diamond CoatingsResearch on Photoelectric Properties of Nanowires Doped DSSC; Design and Performance of the Transverse Rotating Magnetic Field Steered Arc Source Used in Vacuum Arc Deposition; Influence of Technological Parameter on Boehmite Sol Sealing Anodized Al 2024 Alloy; Fatigue Prediction for Pump End of High Pressure Fracturing Pump; Influence of Heat-Treatment on High-Phosphorus Ni-P Plating Coating | ||
500 | |a Effects of Oxide Powders and Nanocrystalline Particles on the Sintering of Al2O3 Glass-CeramicsThe Relationship between Substrate Roughness and Wettability of Superhydrophobic Metal Carboxylate Surface; Review of Technology and Industry on Inorganic Non-Metallic Materials; Growth Characteristics, Microstructure and Corrosion Resistance of Micro-Arc Oxidation Coatings Fabricated on ZK60 Mg Alloy under Two Steps Voltage-Increasing Mode; Study on a Quinoline Inhibitor Used for Sulfur Corrosion on Carbon Steel: Properties Research and Field Test | ||
500 | |a Effect of Phosphating Additives on Corrosion Resistance of Phosphate Coatings on AZ91D Magnesium AlloyFabrication and Characterization of Cellulose Acetate Ultrafine Fiber Containing Silver Nanoparticles by Electrospinning; The Optical Properties of DLC Films Processed by Laser Radiation; Study on CO2 Emission in the Process of Dealing with Vanadium-Titanium Magnetite; Ni-Induced Lateral Fast Crystallization of Amorphous Silicon Film by Microwave Annealing; Preparation and Performance of Zr(Ca)-Al-O-N Composites by Reaction Sintering of Al-ZrO2(Ca) in N2 Atmosphere | ||
500 | |a This work's contents were subjected to strict peer-review by experts, and describe the latest advances and applications in the fields of surface engineering/coatings, modeling, analysis and simulation of manufacturing processes, materials forming/machining/joining, mechanical behavior and fracture, tooling testing and evaluation of materials. Review from Book News Inc.: Nearly 150 papers cover surface engineering/coatings; modeling, analyzing, and simulating manufacturing processes; materials forming/machining/joining; mechanical behavior and fracture; and tooling testing and evaluating materi | ||
650 | 7 | |a TECHNOLOGY & ENGINEERING / Industrial Engineering |2 bisacsh | |
650 | 7 | |a TECHNOLOGY & ENGINEERING / Industrial Technology |2 bisacsh | |
650 | 7 | |a TECHNOLOGY & ENGINEERING / Manufacturing |2 bisacsh | |
650 | 7 | |a TECHNOLOGY & ENGINEERING / Technical & Manufacturing Industries & Trades |2 bisacsh | |
650 | 7 | |a Manufacturing processes |2 fast | |
650 | 7 | |a Materials |2 fast | |
650 | 4 | |a Manufacturing processes |v Congresses | |
650 | 4 | |a Materials |v Congresses | |
655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |2 gnd-content | |
700 | 1 | |a Yarlagadda, Prasad K. D. V. |4 edt | |
830 | 0 | |a Advanced materials research |v 337 |w (DE-604)BV035441301 |9 337 | |
912 | |a ZDB-4-EBA | ||
999 | |a oai:aleph.bib-bvb.de:BVB01-029186873 | ||
966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553238 |l FAW01 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553238 |l FAW02 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext |
Record in the Search Index
_version_ | 1804176601920831489 |
---|---|
any_adam_object | |
author2 | Yarlagadda, Prasad K. D. V. |
author2_role | edt |
author2_variant | p k d v y pkdv pkdvy |
author_corporate | International Conference on Materials and Products Manufacturing Technology Chengdu |
author_corporate_role | aut |
author_facet | Yarlagadda, Prasad K. D. V. International Conference on Materials and Products Manufacturing Technology Chengdu |
author_sort | International Conference on Materials and Products Manufacturing Technology Chengdu |
building | Verbundindex |
bvnumber | BV043775813 |
collection | ZDB-4-EBA |
ctrlnum | (ZDB-4-EBA)ocn838128414 (OCoLC)838128414 (DE-599)BVBBV043775813 |
dewey-full | 670 |
dewey-hundreds | 600 - Technology (Applied sciences) |
dewey-ones | 670 - Manufacturing |
dewey-raw | 670 |
dewey-search | 670 |
dewey-sort | 3670 |
dewey-tens | 670 - Manufacturing |
discipline | Werkstoffwissenschaften / Fertigungstechnik |
format | Electronic Conference Proceeding eBook |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>05908nmm a2200601zcb4500</leader><controlfield tag="001">BV043775813</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20180206 </controlfield><controlfield tag="006">a |||| 10||| </controlfield><controlfield tag="007">cr|uuu---uuuuu</controlfield><controlfield tag="008">160920s2011 |||| o||u| ||||||eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038136477</subfield><subfield code="9">978-3-03813-647-7</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038136476</subfield><subfield code="9">3-03813-647-6</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783037852477</subfield><subfield code="9">978-3-03785-247-7</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">303785247X</subfield><subfield code="9">3-03785-247-X</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(ZDB-4-EBA)ocn838128414</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)838128414</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043775813</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">aacr</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-1046</subfield><subfield code="a">DE-1047</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">670</subfield><subfield code="2">23</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Conference on Materials and Products Manufacturing Technology</subfield><subfield code="n">1.</subfield><subfield code="d">2011</subfield><subfield code="c">Chengdu</subfield><subfield code="j">Verfasser</subfield><subfield code="0">(DE-588)111728574X</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Materials processing technology</subfield><subfield code="b">selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China</subfield><subfield code="c">edited by Prasad Yarlagadda [and others]</subfield></datafield><datafield tag="246" ind1="1" ind2="3"><subfield code="a">ICMPMT 2011</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Durnten, Switzerland</subfield><subfield code="b">Trans Tech Publications</subfield><subfield code="c">© 2011</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xviii, 805 pages</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Advanced materials research</subfield><subfield code="v">v. 337</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and indexes</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Materials Processing Technology, ICMPMT2011; Preface and Organizing Committees; Table of Contents; Chapter 1: Surface Engineering/Coatings; Mechanical Behaviours of Pumpkin Peel under Compression Test; Effect of Plasticizer of Sizing Agent on the Surface of Carbon Fibers and Interface of its Composites; Design of Gold Bead Chain Machine Based on Modern Design Methodology; Effect of Cold Reduction Ratio and Annealing Temperature on Microstructure and Mechanical Property of 240MPa Grade High Strength if Steel; Characterization of Micro-Arc Oxidation Coatings Formed on Biomedical Ni-Cr-Mo Alloy</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Study on TC4 Titanium Alloy by Laser Oxygen-Diffused Hardening Process under Different Gas AtmosphereNovel Functional Coating: Luminescent Coating; Mechanical Damping Properties of Silicone Rubber Prepared by Nano-SiO2 and AGE-Modified Polysiloxane Blends; Research on Key Technology of Ultra-High 3D Strengthening Heat Transfer in Plow Machining; Study on Properties of Electroless Ni-P Plating on 6063A Aluminum Alloy; Corrosion Resistance of Ni-CeO2 Nanocomposite Coating Prepared by Electrodeposition with Rotating Cathode in an Ultrasonic Field</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Effects of Two-Step DC Electrochemical Pretreatment of Fine Grinding WC-Co Tool Surface on Morphology and Quality of Diamond CoatingsResearch on Photoelectric Properties of Nanowires Doped DSSC; Design and Performance of the Transverse Rotating Magnetic Field Steered Arc Source Used in Vacuum Arc Deposition; Influence of Technological Parameter on Boehmite Sol Sealing Anodized Al 2024 Alloy; Fatigue Prediction for Pump End of High Pressure Fracturing Pump; Influence of Heat-Treatment on High-Phosphorus Ni-P Plating Coating</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Effects of Oxide Powders and Nanocrystalline Particles on the Sintering of Al2O3 Glass-CeramicsThe Relationship between Substrate Roughness and Wettability of Superhydrophobic Metal Carboxylate Surface; Review of Technology and Industry on Inorganic Non-Metallic Materials; Growth Characteristics, Microstructure and Corrosion Resistance of Micro-Arc Oxidation Coatings Fabricated on ZK60 Mg Alloy under Two Steps Voltage-Increasing Mode; Study on a Quinoline Inhibitor Used for Sulfur Corrosion on Carbon Steel: Properties Research and Field Test</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Effect of Phosphating Additives on Corrosion Resistance of Phosphate Coatings on AZ91D Magnesium AlloyFabrication and Characterization of Cellulose Acetate Ultrafine Fiber Containing Silver Nanoparticles by Electrospinning; The Optical Properties of DLC Films Processed by Laser Radiation; Study on CO2 Emission in the Process of Dealing with Vanadium-Titanium Magnetite; Ni-Induced Lateral Fast Crystallization of Amorphous Silicon Film by Microwave Annealing; Preparation and Performance of Zr(Ca)-Al-O-N Composites by Reaction Sintering of Al-ZrO2(Ca) in N2 Atmosphere</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">This work's contents were subjected to strict peer-review by experts, and describe the latest advances and applications in the fields of surface engineering/coatings, modeling, analysis and simulation of manufacturing processes, materials forming/machining/joining, mechanical behavior and fracture, tooling testing and evaluation of materials. Review from Book News Inc.: Nearly 150 papers cover surface engineering/coatings; modeling, analyzing, and simulating manufacturing processes; materials forming/machining/joining; mechanical behavior and fracture; and tooling testing and evaluating materi</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING / Industrial Engineering</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING / Industrial Technology</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING / Manufacturing</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING / Technical & Manufacturing Industries & Trades</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Manufacturing processes</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Materials</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Manufacturing processes</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Materials</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Yarlagadda, Prasad K. D. V.</subfield><subfield code="4">edt</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Advanced materials research</subfield><subfield code="v">337</subfield><subfield code="w">(DE-604)BV035441301</subfield><subfield code="9">337</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-029186873</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553238</subfield><subfield code="l">FAW01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=553238</subfield><subfield code="l">FAW02</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield></record></collection> |
genre | (DE-588)1071861417 Konferenzschrift gnd-content |
genre_facet | Konferenzschrift |
id | DE-604.BV043775813 |
illustrated | Not Illustrated |
indexdate | 2024-07-10T07:34:47Z |
institution | BVB |
institution_GND | (DE-588)111728574X |
isbn | 9783038136477 3038136476 9783037852477 303785247X |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-029186873 |
oclc_num | 838128414 |
open_access_boolean | |
owner | DE-1046 DE-1047 |
owner_facet | DE-1046 DE-1047 |
physical | xviii, 805 pages |
psigel | ZDB-4-EBA ZDB-4-EBA FAW_PDA_EBA |
publishDate | 2011 |
publishDateSearch | 2011 |
publishDateSort | 2011 |
publisher | Trans Tech Publications |
record_format | marc |
series | Advanced materials research |
series2 | Advanced materials research |
spelling | International Conference on Materials and Products Manufacturing Technology 1. 2011 Chengdu Verfasser (DE-588)111728574X aut Materials processing technology selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China edited by Prasad Yarlagadda [and others] ICMPMT 2011 Durnten, Switzerland Trans Tech Publications © 2011 xviii, 805 pages txt rdacontent c rdamedia cr rdacarrier Advanced materials research v. 337 Includes bibliographical references and indexes Materials Processing Technology, ICMPMT2011; Preface and Organizing Committees; Table of Contents; Chapter 1: Surface Engineering/Coatings; Mechanical Behaviours of Pumpkin Peel under Compression Test; Effect of Plasticizer of Sizing Agent on the Surface of Carbon Fibers and Interface of its Composites; Design of Gold Bead Chain Machine Based on Modern Design Methodology; Effect of Cold Reduction Ratio and Annealing Temperature on Microstructure and Mechanical Property of 240MPa Grade High Strength if Steel; Characterization of Micro-Arc Oxidation Coatings Formed on Biomedical Ni-Cr-Mo Alloy Study on TC4 Titanium Alloy by Laser Oxygen-Diffused Hardening Process under Different Gas AtmosphereNovel Functional Coating: Luminescent Coating; Mechanical Damping Properties of Silicone Rubber Prepared by Nano-SiO2 and AGE-Modified Polysiloxane Blends; Research on Key Technology of Ultra-High 3D Strengthening Heat Transfer in Plow Machining; Study on Properties of Electroless Ni-P Plating on 6063A Aluminum Alloy; Corrosion Resistance of Ni-CeO2 Nanocomposite Coating Prepared by Electrodeposition with Rotating Cathode in an Ultrasonic Field Effects of Two-Step DC Electrochemical Pretreatment of Fine Grinding WC-Co Tool Surface on Morphology and Quality of Diamond CoatingsResearch on Photoelectric Properties of Nanowires Doped DSSC; Design and Performance of the Transverse Rotating Magnetic Field Steered Arc Source Used in Vacuum Arc Deposition; Influence of Technological Parameter on Boehmite Sol Sealing Anodized Al 2024 Alloy; Fatigue Prediction for Pump End of High Pressure Fracturing Pump; Influence of Heat-Treatment on High-Phosphorus Ni-P Plating Coating Effects of Oxide Powders and Nanocrystalline Particles on the Sintering of Al2O3 Glass-CeramicsThe Relationship between Substrate Roughness and Wettability of Superhydrophobic Metal Carboxylate Surface; Review of Technology and Industry on Inorganic Non-Metallic Materials; Growth Characteristics, Microstructure and Corrosion Resistance of Micro-Arc Oxidation Coatings Fabricated on ZK60 Mg Alloy under Two Steps Voltage-Increasing Mode; Study on a Quinoline Inhibitor Used for Sulfur Corrosion on Carbon Steel: Properties Research and Field Test Effect of Phosphating Additives on Corrosion Resistance of Phosphate Coatings on AZ91D Magnesium AlloyFabrication and Characterization of Cellulose Acetate Ultrafine Fiber Containing Silver Nanoparticles by Electrospinning; The Optical Properties of DLC Films Processed by Laser Radiation; Study on CO2 Emission in the Process of Dealing with Vanadium-Titanium Magnetite; Ni-Induced Lateral Fast Crystallization of Amorphous Silicon Film by Microwave Annealing; Preparation and Performance of Zr(Ca)-Al-O-N Composites by Reaction Sintering of Al-ZrO2(Ca) in N2 Atmosphere This work's contents were subjected to strict peer-review by experts, and describe the latest advances and applications in the fields of surface engineering/coatings, modeling, analysis and simulation of manufacturing processes, materials forming/machining/joining, mechanical behavior and fracture, tooling testing and evaluation of materials. Review from Book News Inc.: Nearly 150 papers cover surface engineering/coatings; modeling, analyzing, and simulating manufacturing processes; materials forming/machining/joining; mechanical behavior and fracture; and tooling testing and evaluating materi TECHNOLOGY & ENGINEERING / Industrial Engineering bisacsh TECHNOLOGY & ENGINEERING / Industrial Technology bisacsh TECHNOLOGY & ENGINEERING / Manufacturing bisacsh TECHNOLOGY & ENGINEERING / Technical & Manufacturing Industries & Trades bisacsh Manufacturing processes fast Materials fast Manufacturing processes Congresses Materials Congresses (DE-588)1071861417 Konferenzschrift gnd-content Yarlagadda, Prasad K. D. V. edt Advanced materials research 337 (DE-604)BV035441301 337 |
spellingShingle | Materials processing technology selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China Advanced materials research TECHNOLOGY & ENGINEERING / Industrial Engineering bisacsh TECHNOLOGY & ENGINEERING / Industrial Technology bisacsh TECHNOLOGY & ENGINEERING / Manufacturing bisacsh TECHNOLOGY & ENGINEERING / Technical & Manufacturing Industries & Trades bisacsh Manufacturing processes fast Materials fast Manufacturing processes Congresses Materials Congresses |
subject_GND | (DE-588)1071861417 |
title | Materials processing technology selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China |
title_alt | ICMPMT 2011 |
title_auth | Materials processing technology selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China |
title_exact_search | Materials processing technology selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China |
title_full | Materials processing technology selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China edited by Prasad Yarlagadda [and others] |
title_fullStr | Materials processing technology selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China edited by Prasad Yarlagadda [and others] |
title_full_unstemmed | Materials processing technology selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China edited by Prasad Yarlagadda [and others] |
title_short | Materials processing technology |
title_sort | materials processing technology selected peer reviewed papers from the 2011 international conference on materials and products manufacturing technology icmpmt 2011 october 28 30 2011 chengdu china |
title_sub | selected, peer reviewed papers from the 2011 International Conference on Materials and Products Manufacturing Technology (ICMPMT 2011), October 28-30, 2011, Chengdu, China |
topic | TECHNOLOGY & ENGINEERING / Industrial Engineering bisacsh TECHNOLOGY & ENGINEERING / Industrial Technology bisacsh TECHNOLOGY & ENGINEERING / Manufacturing bisacsh TECHNOLOGY & ENGINEERING / Technical & Manufacturing Industries & Trades bisacsh Manufacturing processes fast Materials fast Manufacturing processes Congresses Materials Congresses |
topic_facet | TECHNOLOGY & ENGINEERING / Industrial Engineering TECHNOLOGY & ENGINEERING / Industrial Technology TECHNOLOGY & ENGINEERING / Manufacturing TECHNOLOGY & ENGINEERING / Technical & Manufacturing Industries & Trades Manufacturing processes Materials Manufacturing processes Congresses Materials Congresses Konferenzschrift |
volume_link | (DE-604)BV035441301 |
work_keys_str_mv | AT internationalconferenceonmaterialsandproductsmanufacturingtechnologychengdu materialsprocessingtechnologyselectedpeerreviewedpapersfromthe2011internationalconferenceonmaterialsandproductsmanufacturingtechnologyicmpmt2011october28302011chengduchina AT yarlagaddaprasadkdv materialsprocessingtechnologyselectedpeerreviewedpapersfromthe2011internationalconferenceonmaterialsandproductsmanufacturingtechnologyicmpmt2011october28302011chengduchina AT internationalconferenceonmaterialsandproductsmanufacturingtechnologychengdu icmpmt2011 AT yarlagaddaprasadkdv icmpmt2011 |