The public financiers: Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Houndmills, Basingstoke, Hampshire ; New York, NY
Palgrave Macmillan
2016
|
| Schriftenreihe: | Great minds in finance
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | xiv, 244 Seiten Diagramme |
| ISBN: | 9781137341334 9781349577729 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV043382068 | ||
| 003 | DE-604 | ||
| 005 | 20190826 | ||
| 007 | t | ||
| 008 | 160222s2016 xxk|||| |||| 00||| eng d | ||
| 010 | |a 015020355 | ||
| 020 | |a 9781137341334 |c hbk. |9 978-1-137-34133-4 | ||
| 020 | |a 9781349577729 |c pbk. |9 978-1-349-57772-9 | ||
| 035 | |a (OCoLC)951136426 | ||
| 035 | |a (DE-599)BVBBV043382068 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 044 | |a xxk |c GB | ||
| 049 | |a DE-355 |a DE-19 |a DE-N2 |a DE-521 |a DE-188 | ||
| 050 | 0 | |a HG171 | |
| 082 | 0 | |a 332.092/2 |2 23 | |
| 084 | |a QE 800 |0 (DE-625)141302: |2 rvk | ||
| 100 | 1 | |a Read, Colin |d 1959- |e Verfasser |0 (DE-588)138263019 |4 aut | |
| 245 | 1 | 0 | |a The public financiers |b Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz |c Colin Read (Professor of Economics and Finance, SUNY College at Plattsburgh, USA) |
| 264 | 1 | |a Houndmills, Basingstoke, Hampshire ; New York, NY |b Palgrave Macmillan |c 2016 | |
| 300 | |a xiv, 244 Seiten |b Diagramme | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 0 | |a Great minds in finance | |
| 650 | 4 | |a Geschichte | |
| 650 | 4 | |a Wirtschaft | |
| 650 | 4 | |a Finance |x History | |
| 650 | 4 | |a Economics |x History | |
| 650 | 4 | |a Economists | |
| 650 | 0 | 7 | |a Finanzwissenschaft |0 (DE-588)4121273-3 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Wirtschaftswissenschaftler |0 (DE-588)4066533-1 |2 gnd |9 rswk-swf |
| 655 | 7 | |0 (DE-588)4006804-3 |a Biografie |2 gnd-content | |
| 689 | 0 | 0 | |a Finanzwissenschaft |0 (DE-588)4121273-3 |D s |
| 689 | 0 | 1 | |a Wirtschaftswissenschaftler |0 (DE-588)4066533-1 |D s |
| 689 | 0 | |C b |5 DE-604 | |
| 856 | 4 | 2 | |m Digitalisierung UB Regensburg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=028800727&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-028800727 | ||
Datensatz im Suchindex
| _version_ | 1804175948116918272 |
|---|---|
| adam_text | Contents
List of Figures vi i i
Series Preface ix
Preface to This Volume xiv
Introduction 1
Section 1 First Forays into Tax Incidence and Public
Policy
1 The Early Life of David Ricardo 7
2 The Times 14
3 The Theory 17
4 f fie Later Life of David Ricardo 22
5 The Early Life of Henry George 26
6 The Times 34
7 The Theory of Progress and Poverty 41
8 Legacy and Later Life 46
9 John Bates Clark in Defense of the Status Quo 49
10 John Bates Clark and His Times 58
I 1 Later Life and Legacy of Henry George 69
12 Later Life and Legacy of John Bates Clark 71
Section 2 From Burden of Taxation to Optimal
Taxation
13 The Early Years of Frank Plumpton Ramsey 75
14 The Paper That Spawned the Study of Optimal Taxation 85
15 A Short Lifetime of Contributions 91
V
96
98
99
104
113
121
127
129
132
137
144
150
164
169
174
180
182
185
187
191
200
206
208
212
vi Contents
16 The Premature Loss of a Great Mind
17 A Modem Extension - Vickrey and Mirrlees
18 The Early Life of William Spencer Vickrey
19 The Early Life of James Mirrlees
20 The Great Idea
21 Legacy and Applications
22 The Nobel Prize
23 The Later Years of James Alexander Mirrlees
24 The Later Years of William Spencer Vickrey
Section 3 Divergent Arguments for the Public Sector
25 The Early Life of Knut Wicksell
26 The Early Life of Richard Musgrave
27 The Early Life of James Buchanan
28 The Great Idea of Knut Wicksell
29 The Times and a New Role for Government
30 The Great Debate Between Musgrave and Buchanan
31 The Nobel Memorial Prize for James Buchanan
32 The Legacy of Knut Wicksell
33 The Later Years of Richard Musgrave
34 The Legacy and Later Years of James Buchanan
Section 4 Bringing it all Together - Voting with the
Feet and the Henry George Theorem
35 The Early Life of Charles Tiebout
36 The Early Life of Joseph Stiglitz
37 The Times of Charles Mills Tiebout
38 The Great Idea of Charles Mills Tiebout
39 Applications and Extensions
Contents vii
40 The Early Death of Charles Tiebout 215
41 The Henry George Theorem 217
42 The Prize and Legacy of Joseph Stiglitz 220
Section 5 What We Have Learned
Conclusions 229
Glossary 231
Notes 235
Index
242
|
| any_adam_object | 1 |
| author | Read, Colin 1959- |
| author_GND | (DE-588)138263019 |
| author_facet | Read, Colin 1959- |
| author_role | aut |
| author_sort | Read, Colin 1959- |
| author_variant | c r cr |
| building | Verbundindex |
| bvnumber | BV043382068 |
| callnumber-first | H - Social Science |
| callnumber-label | HG171 |
| callnumber-raw | HG171 |
| callnumber-search | HG171 |
| callnumber-sort | HG 3171 |
| callnumber-subject | HG - Finance |
| classification_rvk | QE 800 |
| ctrlnum | (OCoLC)951136426 (DE-599)BVBBV043382068 |
| dewey-full | 332.092/2 |
| dewey-hundreds | 300 - Social sciences |
| dewey-ones | 332 - Financial economics |
| dewey-raw | 332.092/2 |
| dewey-search | 332.092/2 |
| dewey-sort | 3332.092 12 |
| dewey-tens | 330 - Economics |
| discipline | Wirtschaftswissenschaften |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02002nam a2200481 c 4500</leader><controlfield tag="001">BV043382068</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20190826 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">160222s2016 xxk|||| |||| 00||| eng d</controlfield><datafield tag="010" ind1=" " ind2=" "><subfield code="a">015020355</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781137341334</subfield><subfield code="c">hbk.</subfield><subfield code="9">978-1-137-34133-4</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781349577729</subfield><subfield code="c">pbk.</subfield><subfield code="9">978-1-349-57772-9</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)951136426</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043382068</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">xxk</subfield><subfield code="c">GB</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-355</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-N2</subfield><subfield code="a">DE-521</subfield><subfield code="a">DE-188</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">HG171</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">332.092/2</subfield><subfield code="2">23</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">QE 800</subfield><subfield code="0">(DE-625)141302:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Read, Colin</subfield><subfield code="d">1959-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)138263019</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The public financiers</subfield><subfield code="b">Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz</subfield><subfield code="c">Colin Read (Professor of Economics and Finance, SUNY College at Plattsburgh, USA)</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Houndmills, Basingstoke, Hampshire ; New York, NY</subfield><subfield code="b">Palgrave Macmillan</subfield><subfield code="c">2016</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xiv, 244 Seiten</subfield><subfield code="b">Diagramme</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Great minds in finance</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Geschichte</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Wirtschaft</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Finance</subfield><subfield code="x">History</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Economics</subfield><subfield code="x">History</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Economists</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Finanzwissenschaft</subfield><subfield code="0">(DE-588)4121273-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Wirtschaftswissenschaftler</subfield><subfield code="0">(DE-588)4066533-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)4006804-3</subfield><subfield code="a">Biografie</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Finanzwissenschaft</subfield><subfield code="0">(DE-588)4121273-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Wirtschaftswissenschaftler</subfield><subfield code="0">(DE-588)4066533-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="C">b</subfield><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Regensburg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=028800727&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-028800727</subfield></datafield></record></collection> |
| genre | (DE-588)4006804-3 Biografie gnd-content |
| genre_facet | Biografie |
| id | DE-604.BV043382068 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-10T07:24:23Z |
| institution | BVB |
| isbn | 9781137341334 9781349577729 |
| language | English |
| lccn | 015020355 |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-028800727 |
| oclc_num | 951136426 |
| open_access_boolean | |
| owner | DE-355 DE-BY-UBR DE-19 DE-BY-UBM DE-N2 DE-521 DE-188 |
| owner_facet | DE-355 DE-BY-UBR DE-19 DE-BY-UBM DE-N2 DE-521 DE-188 |
| physical | xiv, 244 Seiten Diagramme |
| publishDate | 2016 |
| publishDateSearch | 2016 |
| publishDateSort | 2016 |
| publisher | Palgrave Macmillan |
| record_format | marc |
| series2 | Great minds in finance |
| spelling | Read, Colin 1959- Verfasser (DE-588)138263019 aut The public financiers Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz Colin Read (Professor of Economics and Finance, SUNY College at Plattsburgh, USA) Houndmills, Basingstoke, Hampshire ; New York, NY Palgrave Macmillan 2016 xiv, 244 Seiten Diagramme txt rdacontent n rdamedia nc rdacarrier Great minds in finance Geschichte Wirtschaft Finance History Economics History Economists Finanzwissenschaft (DE-588)4121273-3 gnd rswk-swf Wirtschaftswissenschaftler (DE-588)4066533-1 gnd rswk-swf (DE-588)4006804-3 Biografie gnd-content Finanzwissenschaft (DE-588)4121273-3 s Wirtschaftswissenschaftler (DE-588)4066533-1 s b DE-604 Digitalisierung UB Regensburg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=028800727&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Read, Colin 1959- The public financiers Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz Geschichte Wirtschaft Finance History Economics History Economists Finanzwissenschaft (DE-588)4121273-3 gnd Wirtschaftswissenschaftler (DE-588)4066533-1 gnd |
| subject_GND | (DE-588)4121273-3 (DE-588)4066533-1 (DE-588)4006804-3 |
| title | The public financiers Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz |
| title_auth | The public financiers Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz |
| title_exact_search | The public financiers Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz |
| title_full | The public financiers Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz Colin Read (Professor of Economics and Finance, SUNY College at Plattsburgh, USA) |
| title_fullStr | The public financiers Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz Colin Read (Professor of Economics and Finance, SUNY College at Plattsburgh, USA) |
| title_full_unstemmed | The public financiers Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz Colin Read (Professor of Economics and Finance, SUNY College at Plattsburgh, USA) |
| title_short | The public financiers |
| title_sort | the public financiers ricardo george clark ramsey mirrlees vickrey wicksell musgrave buchanan tiebout and stiglitz |
| title_sub | Ricardo, George, Clark, Ramsey, Mirrlees, Vickrey, Wicksell, Musgrave, Buchanan, Tiebout, and Stiglitz |
| topic | Geschichte Wirtschaft Finance History Economics History Economists Finanzwissenschaft (DE-588)4121273-3 gnd Wirtschaftswissenschaftler (DE-588)4066533-1 gnd |
| topic_facet | Geschichte Wirtschaft Finance History Economics History Economists Finanzwissenschaft Wirtschaftswissenschaftler Biografie |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=028800727&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT readcolin thepublicfinanciersricardogeorgeclarkramseymirrleesvickreywicksellmusgravebuchanantieboutandstiglitz |