Elements of a neurobiological theory of the hippocampus: the role of activity-dependent synaptic plasticity in memory
Saved in:
Main Author: | |
---|---|
Format: | Electronic eBook |
Language: | English |
Published: |
Amsterdam
Vossiuspers UvA
c2005
|
Subjects: | |
Online Access: | FAW01 FAW02 Volltext |
Item Description: | "2004 Frijda Lecture, Cognitive Science Center, Amsterdam." Includes bibliographical references (p. 34-41) The hippocampal formation and memory -- Elements of a neurobiological theory of the hippocampus and the role of NMDA receptor-dependent synaptic plasticity -- Experimental observations -- Conclusion -- References |
Physical Description: | 1 Online-Ressource (41 p.) |
ISBN: | 1441610340 9781441610348 |
Staff View
MARC
LEADER | 00000nmm a2200000zc 4500 | ||
---|---|---|---|
001 | BV043071625 | ||
003 | DE-604 | ||
005 | 00000000000000.0 | ||
007 | cr|uuu---uuuuu | ||
008 | 151126s2005 |||| o||u| ||||||eng d | ||
020 | |a 1441610340 |c electronic bk. |9 1-4416-1034-0 | ||
020 | |a 9781441610348 |c electronic bk. |9 978-1-4416-1034-8 | ||
035 | |a (OCoLC)435447325 | ||
035 | |a (DE-599)BVBBV043071625 | ||
040 | |a DE-604 |b ger |e aacr | ||
041 | 0 | |a eng | |
049 | |a DE-1046 |a DE-1047 | ||
082 | 0 | |a 573.8/6 |2 22 | |
100 | 1 | |a Morris, R. G. M., (Richard G. M.) |e Verfasser |4 aut | |
245 | 1 | 0 | |a Elements of a neurobiological theory of the hippocampus |b the role of activity-dependent synaptic plasticity in memory |c R.G.M. Morris |
264 | 1 | |a Amsterdam |b Vossiuspers UvA |c c2005 | |
300 | |a 1 Online-Ressource (41 p.) | ||
336 | |b txt |2 rdacontent | ||
337 | |b c |2 rdamedia | ||
338 | |b cr |2 rdacarrier | ||
500 | |a "2004 Frijda Lecture, Cognitive Science Center, Amsterdam." | ||
500 | |a Includes bibliographical references (p. 34-41) | ||
500 | |a The hippocampal formation and memory -- Elements of a neurobiological theory of the hippocampus and the role of NMDA receptor-dependent synaptic plasticity -- Experimental observations -- Conclusion -- References | ||
650 | 7 | |a SOCIAL SCIENCE / Anthropology / Physical |2 bisacsh | |
650 | 7 | |a Hippocampus (Brain) |2 fast | |
650 | 7 | |a Memory |2 fast | |
650 | 4 | |a Hippocampus (Brain) | |
650 | 4 | |a Memory | |
856 | 4 | 0 | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=158067 |x Aggregator |3 Volltext |
912 | |a ZDB-4-EBA | ||
999 | |a oai:aleph.bib-bvb.de:BVB01-028495816 | ||
966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=158067 |l FAW01 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext | |
966 | e | |u http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=158067 |l FAW02 |p ZDB-4-EBA |q FAW_PDA_EBA |x Aggregator |3 Volltext |
Record in the Search Index
_version_ | 1804175455503253504 |
---|---|
any_adam_object | |
author | Morris, R. G. M., (Richard G. M.) |
author_facet | Morris, R. G. M., (Richard G. M.) |
author_role | aut |
author_sort | Morris, R. G. M., (Richard G. M.) |
author_variant | r g m r g m m rgmrgm rgmrgmm |
building | Verbundindex |
bvnumber | BV043071625 |
collection | ZDB-4-EBA |
ctrlnum | (OCoLC)435447325 (DE-599)BVBBV043071625 |
dewey-full | 573.8/6 |
dewey-hundreds | 500 - Natural sciences and mathematics |
dewey-ones | 573 - Specific physiological systems in animals |
dewey-raw | 573.8/6 |
dewey-search | 573.8/6 |
dewey-sort | 3573.8 16 |
dewey-tens | 570 - Biology |
discipline | Biologie |
format | Electronic eBook |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01976nmm a2200421zc 4500</leader><controlfield tag="001">BV043071625</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">00000000000000.0</controlfield><controlfield tag="007">cr|uuu---uuuuu</controlfield><controlfield tag="008">151126s2005 |||| o||u| ||||||eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">1441610340</subfield><subfield code="c">electronic bk.</subfield><subfield code="9">1-4416-1034-0</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781441610348</subfield><subfield code="c">electronic bk.</subfield><subfield code="9">978-1-4416-1034-8</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)435447325</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV043071625</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">aacr</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-1046</subfield><subfield code="a">DE-1047</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">573.8/6</subfield><subfield code="2">22</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Morris, R. G. M., (Richard G. M.)</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Elements of a neurobiological theory of the hippocampus</subfield><subfield code="b">the role of activity-dependent synaptic plasticity in memory</subfield><subfield code="c">R.G.M. Morris</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Amsterdam</subfield><subfield code="b">Vossiuspers UvA</subfield><subfield code="c">c2005</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 Online-Ressource (41 p.)</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">"2004 Frijda Lecture, Cognitive Science Center, Amsterdam."</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references (p. 34-41)</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">The hippocampal formation and memory -- Elements of a neurobiological theory of the hippocampus and the role of NMDA receptor-dependent synaptic plasticity -- Experimental observations -- Conclusion -- References</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">SOCIAL SCIENCE / Anthropology / Physical</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Hippocampus (Brain)</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Memory</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Hippocampus (Brain)</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Memory</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=158067</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-028495816</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=158067</subfield><subfield code="l">FAW01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="966" ind1="e" ind2=" "><subfield code="u">http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=158067</subfield><subfield code="l">FAW02</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FAW_PDA_EBA</subfield><subfield code="x">Aggregator</subfield><subfield code="3">Volltext</subfield></datafield></record></collection> |
id | DE-604.BV043071625 |
illustrated | Not Illustrated |
indexdate | 2024-07-10T07:16:34Z |
institution | BVB |
isbn | 1441610340 9781441610348 |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-028495816 |
oclc_num | 435447325 |
open_access_boolean | |
owner | DE-1046 DE-1047 |
owner_facet | DE-1046 DE-1047 |
physical | 1 Online-Ressource (41 p.) |
psigel | ZDB-4-EBA ZDB-4-EBA FAW_PDA_EBA |
publishDate | 2005 |
publishDateSearch | 2005 |
publishDateSort | 2005 |
publisher | Vossiuspers UvA |
record_format | marc |
spelling | Morris, R. G. M., (Richard G. M.) Verfasser aut Elements of a neurobiological theory of the hippocampus the role of activity-dependent synaptic plasticity in memory R.G.M. Morris Amsterdam Vossiuspers UvA c2005 1 Online-Ressource (41 p.) txt rdacontent c rdamedia cr rdacarrier "2004 Frijda Lecture, Cognitive Science Center, Amsterdam." Includes bibliographical references (p. 34-41) The hippocampal formation and memory -- Elements of a neurobiological theory of the hippocampus and the role of NMDA receptor-dependent synaptic plasticity -- Experimental observations -- Conclusion -- References SOCIAL SCIENCE / Anthropology / Physical bisacsh Hippocampus (Brain) fast Memory fast Hippocampus (Brain) Memory http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=158067 Aggregator Volltext |
spellingShingle | Morris, R. G. M., (Richard G. M.) Elements of a neurobiological theory of the hippocampus the role of activity-dependent synaptic plasticity in memory SOCIAL SCIENCE / Anthropology / Physical bisacsh Hippocampus (Brain) fast Memory fast Hippocampus (Brain) Memory |
title | Elements of a neurobiological theory of the hippocampus the role of activity-dependent synaptic plasticity in memory |
title_auth | Elements of a neurobiological theory of the hippocampus the role of activity-dependent synaptic plasticity in memory |
title_exact_search | Elements of a neurobiological theory of the hippocampus the role of activity-dependent synaptic plasticity in memory |
title_full | Elements of a neurobiological theory of the hippocampus the role of activity-dependent synaptic plasticity in memory R.G.M. Morris |
title_fullStr | Elements of a neurobiological theory of the hippocampus the role of activity-dependent synaptic plasticity in memory R.G.M. Morris |
title_full_unstemmed | Elements of a neurobiological theory of the hippocampus the role of activity-dependent synaptic plasticity in memory R.G.M. Morris |
title_short | Elements of a neurobiological theory of the hippocampus |
title_sort | elements of a neurobiological theory of the hippocampus the role of activity dependent synaptic plasticity in memory |
title_sub | the role of activity-dependent synaptic plasticity in memory |
topic | SOCIAL SCIENCE / Anthropology / Physical bisacsh Hippocampus (Brain) fast Memory fast Hippocampus (Brain) Memory |
topic_facet | SOCIAL SCIENCE / Anthropology / Physical Hippocampus (Brain) Memory |
url | http://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&db=nlabk&AN=158067 |
work_keys_str_mv | AT morrisrgmrichardgm elementsofaneurobiologicaltheoryofthehippocampustheroleofactivitydependentsynapticplasticityinmemory |