Scriptorium: Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013
Saved in:
| Other Authors: | , , , , |
|---|---|
| Format: | Book |
| Language: | German Italian French English Spanish |
| Published: |
München
Bayerische Akademie der Wissenschaften
[2015]
München C.H. Beck |
| Series: | Veröffentlichungen der Kommission für die Herausgabe der mittelalterlichen Bibliothekskataloge Deutschlands und der Schweiz
|
| Subjects: | |
| Online Access: | Rezension Inhaltsverzeichnis Register // Gemischte Register |
| Physical Description: | 584 Seiten Illustrationen, Diagramme, Karten |
| ISBN: | 9783769610918 3769610911 |
Staff View
MARC
| LEADER | 00000nam a22000008c 4500 | ||
|---|---|---|---|
| 001 | BV042560695 | ||
| 003 | DE-604 | ||
| 005 | 20171201 | ||
| 007 | t | ||
| 008 | 150515s2015 gw a||| |||| 10||| ger d | ||
| 015 | |a 15,N18 |2 dnb | ||
| 016 | 7 | |a 1069865400 |2 DE-101 | |
| 020 | |a 9783769610918 |c Gb. : ca. EUR 148.00 (DE), ca. EUR 152.20 (AT), ca. sfr 206.00 (freier Pr.) |9 978-3-7696-1091-8 | ||
| 020 | |a 3769610911 |9 3-7696-1091-1 | ||
| 024 | 3 | |a 9783769610918 | |
| 035 | |a (OCoLC)927154715 | ||
| 035 | |a (DE-599)DNB1069865400 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a ger |a ita |a fre |a eng |a spa | |
| 044 | |a gw |c XA-DE-BY | ||
| 049 | |a DE-29 |a DE-19 |a DE-M100 |a DE-12 |a DE-Re5 |a DE-B496 |a DE-355 |a DE-22 |a DE-384 |a DE-188 |a DE-20 |a DE-Y3 |a DE-B220 | ||
| 082 | 0 | |a 940 |2 23 | |
| 084 | |a AM 50000 |0 (DE-625)4333: |2 rvk | ||
| 084 | |a AM 50200 |0 (DE-625)4335: |2 rvk | ||
| 084 | |a AN 17900 |0 (DE-625)5808: |2 rvk | ||
| 084 | |a 940 |2 sdnb | ||
| 084 | |a 8 |2 ssgn | ||
| 245 | 1 | 0 | |a Scriptorium |b Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013 |c herausgegeben von Andreas Nievergelt, Rudolf Gamper, Marina Bernasconi Reusser, Birgit Ebersperger, Ernst Tremp |
| 264 | 1 | |a München |b Bayerische Akademie der Wissenschaften |c [2015] | |
| 264 | 1 | |a München |b C.H. Beck | |
| 264 | 4 | |c © 2015 | |
| 300 | |a 584 Seiten |b Illustrationen, Diagramme, Karten | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 0 | |a Veröffentlichungen der Kommission für die Herausgabe der mittelalterlichen Bibliothekskataloge Deutschlands und der Schweiz | |
| 546 | |a Beiträge teilweise deutsch, teilweise englisch, teilweise französisch, teilweise italienisch, teilweise spanisch mit Abstracts in englischer Sprache | ||
| 650 | 0 | 7 | |a Schreibschule |0 (DE-588)4131378-1 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Handschriftenproduktion |0 (DE-588)4398738-2 |2 gnd |9 rswk-swf |
| 655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |y 2013 |z Sankt Gallen |2 gnd-content | |
| 689 | 0 | 0 | |a Handschriftenproduktion |0 (DE-588)4398738-2 |D s |
| 689 | 0 | |5 DE-604 | |
| 689 | 1 | 0 | |a Schreibschule |0 (DE-588)4131378-1 |D s |
| 689 | 1 | |5 DE-604 | |
| 700 | 1 | |a Nievergelt, Andreas |d 1957- |0 (DE-588)1053240643 |4 edt | |
| 700 | 1 | |a Gamper, Rudolf |d 1949- |0 (DE-588)124306519 |4 edt | |
| 700 | 1 | |a Bernasconi, Marina |d 1958- |0 (DE-588)12454617X |4 edt | |
| 700 | 1 | |a Ebersperger, Birgit |0 (DE-588)1050689763 |4 edt | |
| 700 | 1 | |a Tremp, Ernst |d 1948- |0 (DE-588)142971278 |4 edt | |
| 710 | 2 | |a Bayerische Akademie der Wissenschaften |0 (DE-588)2005521-3 |4 isb | |
| 710 | 2 | |a Comité International de Paléographie Latine |e Sonstige |0 (DE-588)5169533-9 |4 oth | |
| 856 | 4 | 2 | |u https://www.recensio.net/r/de9499acfffe4caabc54d54f5a1f5c8b |y rezensiert in: Quellen und Forschungen aus italienischen Archiven und Bibliotheken, 97 (2017), S. 454-455 |3 Rezension |
| 856 | 4 | 2 | |m Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027994397&sequence=000005&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 856 | 4 | 2 | |m Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027994397&sequence=000006&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |3 Register // Gemischte Register |
| 940 | 1 | |n DHB | |
| 940 | 1 | |q DHB_BSB_GNDPERS_I | |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-027994397 | ||
| 942 | 1 | 1 | |c 745.6 |e 22/bsb |
| 942 | 1 | 1 | |c 907.2 |e 22/bsb |
Record in the Search Index
| _version_ | 1804153333075673088 |
|---|---|
| adam_text | Verzeichnis der zitierten Handschriften
Das Register umfasst die zitierten Pergament- und Papierhandschriften. Biblio-
theksorte und Bibliotheksnamen stehen in der jeweiligen Landessprache. Die Papyri
werden am Ende des Registers gesondert aufgelistet.
Admont, Stiftsbibliothek
16 : 384,386
17:386
18 : 384
23 : 385-386
33 : 386
43 : 385
71 : 386
82 : 386
110:386-387
159:386
165 : 386
172 : 386-387
237 : 386-387
267:389
273 : 386-387
275 : 386
282 : 386
292 : 384
298 : 386-387, Farbtafel 11
380:384,386-388
399 : 386-387
434 : 386
451 : 386
506 : 386
529 : 380
638 : 386
650 : 386
672 : 386
708 : 386-387
760 : 386
786 : 384
C-D : 493^198, 501-503, 506-507, 513
Frg. ex 243 : 384
Alba Iulia, Batthyaneum
R II 134 : 426
Angers, Bibliothèque municipale
19 : 234, 236, 239, 241
92 : 234, 236, 239, 241
103 : 236
121 : 234, 236, 239-240
187:234, 236,239-241
283 : 234, 236, 239, 241
400:234, 236, 239,241
676 : 234,236, 239, 241
797 : 234, 236, 239, 241
798 : 234, 236,239, 241
814:234, 236,239, 241
1320:234, 236,239, 241
Avranches, Bibliothèque municipale
35 : 236
50 : 234
58:234, 236,238, 240
72 : 236, 241
73 : 236
75 : 241
76 :236, 241
90 : 236,241
91 : 241
103 : 236, 240
163 : 236, 240
425 : 236
446 : 236
Bamberg, Staatsbibliothek
IX A 111 : 334
Bibl. 40 : 55
Bibl. 41 : 493-497, 499-502, 508-511, 517
Hist. 3 : 336
Lit. 134 : 325, 331,333-334
Pair. 35n : 325
552
Verzeichnis
Patr. 62 : 336
Patr. 64 : 336
Patr. 117 : 334
R. B. 48 : 326
R. B. 49 : 326
Basel, Universitätsbibliothek
A IV 24 : 65
Belluno, Biblioteca Lolliniana
35 : 164, 166
Berlin, Kunstgewerbemuseum
F 396: 413
Berlin, Staatsbibliothek zu Berlin ֊
Preußischer Kulturbesitz
Hamilton 204 : 164,167
Lat. oct. 402 : 453
Theol. lat. fol. 485 : 82
Theol. lat. oct. 100 : 388
Bern, Burgerbibliothek
109 : 221
510 : 216
Bologna, Archivio di Stato
Framm. dant. 1-2 : 164, 167
Bourges, Bibliothèque municipale
17:241
Bratislava, Archív hlavného mesta Bratislavy
EC Lad. 1/19 : 429-430
EC Lad. 1/27 : 432
EC Lad. 2: 429, 431
EC Lad. 2/34 : 427
EC Lad. 3 : 423—424,432
EC Lad. 4 : 432
EC Lad. 6 : 432
EL 11 :428
EL 13 :432
EL 13a: 428,431
EL 18: 423
Urkundenreihe 9 (1288.VI.il) : 433
Bratislava, Múzeum mesta Bratislavy
A/2 : 427
A/5 : 432
A19 : 423,425, Farbtafei 8
A/13 : 423
A/49 : 432
Bratislava, Slovenský národný archív
Knižnica Bratislavskej kapituly
4:432
14 : 422
21 : 422
25 : 422
42 : 428
47 : 426
87 : 422
89 : 422
97: 422
109 : 426
115:422
Bruxelles, Bibliothèque Royale
807: 65
5321-22:269,271
5325-27: 259
5330-32 : 269,271
5336 : 269, 271
5337-38 : 266-267,269,271
5339-44 : 269, 271
5345 : 267, 269, 271
5346-47: 269, 271
5348-52 : 264,269,271-273
5354-61 : 259
5369-73 : 269, 271
5374-75 : 259
5380-84 : 261,269,271
5424-5425 : 266, 269,271,273
5439-43 : 269-271
5447-58 : 263,265,269-271
5459 : 269-271,273
5460-61 : 269-271
5463-67 : 269-271,273
5468 : 269-272
5469 : 269-271
5473 : 269-271
5474-77 : 269-271
5478-83 : 265, 269-271
5499 : 264,269-271
5500-03 : 260,269-271
5504-12 : 269-271
5540 : 269-271
5541-42 : 269-271
5543-45 : 269-271
5546 : 269-271
der zitierten Handschriften
553
5571-72 : 265,269-272
5606-10 : 269-271
5649-67 : 259
9330 : 69
10078-95:259, 261
14614-16 : 164, 167
II 1179:67
Budapest, Országos Széchényi Könyvtár
Clmae 78 : 428
Clmae 92 : 429
Clmae 94 : 425
Clmae 214 : 425
Clmae 215 : 425, Farbtafel 9
Clmae 216 : 427
Clmae 218 : 428
Clmae 219 : 432
Clmae 220 : 425
Clmae 222 : 432
Clmae 395 : 427
Clmae 435 : 425
Calci, Biblioteca dell’Abbazia
Bibbia 1: 117-118
Cambridge, Corpus Christi College
2 : 300, 304
3 : 298, 301-302, 305, 308, Farbtafel 7
4 : 298, 301-302, 305
Cambridge, King’s College
52:213
Cambridge, Trinity College
B.2.34 : 307, Farbtafel 6
B.3.23 : 450
B.10.5 : 315
0.3.57 : 386
R.17.1 : 298-299, 301, 303-306
Canterbury, Dean and Chapter Archives
Chart.Ant. A 41 : 299
Chart. Ant. C 14 : 299
Chart.Ant. C 18a : 299
Chart. Ant. C 115 : 296, 299
Chart. Ant. C 117 : 296,299
Cesena, Biblioteca Malatestiana
D. XXI, VII : 450
Châlons-en-Champagne (Châlons-sur-
Marne), Bibliothèque municipale
53 : 241
54 : 241
73 : 234-235, 237, 239-240
Chantilly, Musée Condé
597: 164
Chicago, University Library
BX.2430 : 168
PQ.4271 : 168
Città del Vaticano, Biblioteca Apostolica
Vaticana
Barb. lat. 588 : 492-493, 495-503, 506-507,
512
Barb. lat. 3644 : 164
Barb. lat. 4086 : 151
Barb. lat. 4092 : 164,167
Borgh. 365 : 164
Chig. I.IV.17: 168
Chig. L.VIII.292 : 167
Chig. L.VIII.305 : 167
Ottob. lat. 182 : 168
Ottob. lat. 1615 : 65
Pal. lat. 3 : 493-503, 508-509, 514
Pal. lat. 4 : 493-503, 508-509, 514
Pal. lat. 5 : 493-503, 508-509, 514
Pal. lat. 24 : 81
Reg.lat.597: 215
Reg. lat. 755 : 210
Reg. lat. 762 : 53, 55
Reg. lat. 1391 : 168
Reg. lat. 1879 : 70
Urb. lat. 694: 168
Vat. gr. 1209 : 85
Vat.gr. 1340 : 501
Vat. lat. 444 : 168
Vat. lat. 693 : 70
Vat. lat. 989 : 168
Vat. lat. 1322 : 87
Vat. lat. 2063 : 168
Vat. lat. 2928 : 168
Vat. lat. 3110: 157,168
Vat. lat. 3199:145, 161,164
Vat. lat. 3357 : 168
Vat. lat. 3867: 81
Vat. lat. 4929 : 224
Vat. lat. 4939: 113
Vat. lat. 5411 : 118
554
Verzeichnis
Vat. lat. 5704 : 87
Vat. lat. 6083 : 112
Vat. lat. 6450: 118
Vat. lat. 10405 : 493^95, 498^199 501-503
508-509,515
Clermont-Ferrand, Bibliothèque municipale
732 :235
Coburg, Landesbibliothek
Cas. 102 : 71
Den Haag, Koninklijke Bibliotheek
73 G9: 68
169 C 3 : 69
Den Haag, Rijksmuseum Meermanno-
Westreenianum
10 D 32 : 70
Dijon, Bibliothèque municipale
144 : 450
145 : 446,450,456,458,460,462
146 :450
147 :450
Dublin, Trinity College Library
52 : 521-522
1709 : 82
El Escorial, Real Biblioteca del Monasterio
de San Lorenzo
T I 6 : 52
Enschede, Rijksmuseum Twenthe
381 : 66
Erlangen, Universitätsbibliothek Erlangen -
Nürnberg
406:331-332
Esztergom, Főszékesegyházi Könyvtár
I. 20 :432
Eton, College Library
112:164,166
Firenze, Archivio di Stato
Arte degli Albergatori 2 : 167
Arte di Calimala 4:167
Arte di Calimala 5 : 167
Capitani di parte guelfa, numeri rossi 1 : 167
Capitani di parte guelfa, numeri rossi 2 : 167
Capitoli del Comune, Registri 14 : 166
Carte Strozziane, s. III. 46 : 158,168
Corporazioni Religiose soppresse 260.221 : 98
Diplomatico:
- Adespote (coperte di libri), 1286 II27 : 145
- Archivio Generale dei Contratti,
1331 II 8 : 166
- Arte dei Mercatanti o Arte di Calimala,
1322 1X3: 166
- Arte del Cambio, 1327 III17 : 166
- Monte Comune o delle Graticole,
1350 W 23 : 166
- Monte Comune o delle Graticole,
1351 VI 28 : 166
- Monte Comune o delle Graticole,
1351 VII 25: 166
- Monte Comune o delle Graticole,
1351 Vili 3 : 166
- Monte Comune o delle Graticole,
1351 Vili 17: 166
- Monte Comune o delle Graticole,
1351 IX 6 : 166
- Monte Comune o delle Graticole,
13511X9 : 166
- Monte Comune o delle Graticole,
1351 IX 29: 166
- Passignano, 1067 IX : 106
- Riformagioni, 1351 X5 : 166
- S. Caterina detta de’ Covi, 1295 XI 3 : 145
- S. Frediano in Cestello, 1301 VII 31 : 166
- S. Frediano in Cestello, 1315 VI 3 : 166
- S. Frediano in Cestello, 1359 III 22 :154
- S. Frediano in Cestello, 1361 V 22 : 154
- S. Iacopo di Ripoli, 1314 Vili 23 : 166
- S. Maria del Carmine, 1340 XI 5 : 166
- S. Maria Novella, 1289 X 27 : 145
- S. Maria Nuova, 1348 VII 30 : 166
- S. Martino al Mugnone, 1348 X 19 : 166
- S. Pier Maggiore, 1338 V 11 : 166
- S. Pier Maggiore, 1338 Vili 17 : 166
- S. Spirito, 1289 I 31 : 145
- S. Spirito, 1296 VII 9 : 145
- Strozzi Uguccioni, 1294 VII 10:145
- Strozzi Uguccioni, 1313 IV 3 : 166
- Vailombrosa, 103 7 I 27 : 93
- Vailombrosa, 1039 VII 3 : 93
Statuti del Comune di Firenze 1 : 145
der zitierten Handschriften
555
Statuti del Comune di Firenze 5:167
Statuti del Comune di Firenze 7:167
Statuti del Comune di Firenze 19 : 166
Statuti del Comune di Firenze 33 : 166
Statuti del Comune di Firenze 34 : 160
Firenze, Biblioteca Medicea Laurenziana
Acq. e doni 91 : 118
Acq. e doni 181 : 118
Acq. e doni 785 : 153
Ashb. 829 : 145-147,161,164
Ashb. App. dant. 1 : 146-147,164
Conventi Soppressi 291 : 96
Conventi Soppressi 305 : 98,101
Conventi Soppressi 308 : 97, 101-102
Conventi Soppressi 311 : 97
Conventi Soppressi 312 : 98
Conventi Soppressi 315 : 96, 101, 105
Conventi Soppressi 316 : 96,105
Conventi Soppressi 321 : 95-96,100,107,
Farbtafel 10
Conventi Soppressi 322 : 96
Conventi Soppressi 324 : 98, 101,103
Conventi Soppressi 325 : 96
Conventi Soppressi 329 : 98
Conventi Soppressi 330 : 97,101
Conventi Soppressi 335 : 97
Conventi Soppressi 336 : 98,101
Conventi Soppressi 385 : 96
Conventi Soppressi 447 : 168
Conventi Soppressi 474 : 97
Conventi Soppressi 554 : 97, 101
Conventi Soppressi 557 : 97, 101
Conventi Soppressi 558 : 97, 101
Conventi Soppressi 563 : 98
Conventi Soppressi 567 : 98-99, 101
Conventi Soppressi 569 : 98-99, 101
Conventi Soppressi 570 : 97, 101
Conventi Soppressi 577 : 98-99
Conventi Soppressi 579 : 98-99
Conventi Soppressi 592 : 96
Fies. 153 : 133
Plut. 5 dex. 7 : 110
Plut. 14.15 : 214
Plut. 15.12 : 118
Plut. 16.8 : 128
Plur. 17.37 : 118
Plut. 23 sin. 3 : 168
Plut. 25 sin. 8 : 157, 168
Plut. 30.21 : 168
Plut. 36.47 : 168
Plut. 39.1 : 81
Plut. 40.12 : 161, 164, 167
Plut. 40.13 : 161,164
Plut. 40.14 : 160, 164, 166, Farbtafel 12
Plut. 40.15: 164
Plut. 40.16 : 145-146,164, 167
Plut. 53.18 : 168
Plut. 76.80 : 154
Plut. 78.11 : 168
Plut. 78.12 : 168
Plut. 78.22 : 168
Plut. 90 sup. 12511: 161, 164, 166
Redi 1721: 150
S. Marco 603 : 168
S. Marco 654 : 168
Strozzi 46 : 168
Strozzi 95 : 168
Strozzi 96: 168
Strozzi 149 : 164,166
Strozzi 150 : 164,166
Strozzi 151 : 165-166
Strozzi 152 : 165-166
Strozzi 153 : 165,167
Strozzi 166 : 154
Firenze, Biblioteca Moreniana
Frullani5: 145, 166
Firenze, Biblioteca Nazionale Centrale
II.I.32 : 165
ILI.39 : 166
ILI. 153 : 145
ILIIL47: 151-152, 162-163
II.IV.587: 165,167
Banco Rari 330 : 165
Conventi Soppressi A.I.1213 : 96
Conventi Soppressi C.V.821 : 98,101
Conventi Soppressi D.VII.822 : 98
Conventi Soppressi E.III.755 : 98
Conventi Soppressi E.VII.931 : 97,101
Conventi Soppressi F.1V.255 : 97
Conventi Soppressi H.VIII.1012 : 166
Conventi Soppressi J.1.19 : 168
Conventi Soppressi J.I.28 : 158, 168
Conventi Soppressi J.V.25 : 168
Conventi Soppressi J.VI. 18 : 168
Conventi Soppressi J.VI.29 : 168
Conventi Soppressi da ordinare 44 striscia
333 : 98-99
Magi. XXIX 199: 158, 168
Nuove Accessioni 120 : 166
Palat. 11 : 166
Palat. 449 : 166
Tordi 567 : 165,167
556
Verzeichnis
Firenze, Biblioteca Riccardiana
845 : 168
872 : 168
1010 : 165,167
1012 : 165
1025 : 146,165,167
1030 bis : 165
1033 : 146,161, 165-166
1048 : 165,167
12223: 168
1523 : 166
1578 : 167
1821 : 167
Genève, Bibliothèque Publique et Universitaire
Comités Latentes 316 : 165,167
Göttweig, Stiftsbibliothek
62 : 403
Graz, Universitätsbibliothek
835:387
Heidelberg, Universitätsbibliothek
Pal. lat. 52 : 525-526
Heiligenkreuz, Stiftsbibliothek
10:388
11 : 398
12 : 398
13:398
37:382,398
46 : 382
56 : 396
61 : 398
77 : 400
78 : 400,406
80 : 388
91 : 380
100 : 405
103 : 398
104 : 382, 394
105 : 400
112:398
115 : 398
122:389,396-397
146:382,398
148 : 388
153 : 397-398
154 : 398
189 : 398-400,406
195 : 398
196:398,403
197: 397
205 : 398
209 : 396-397
215 : 398
219 : 398-399
224:382,402
226 ; 397
235 : 402
256 : 398
257: 396-397
299 : 382, 394, 398
300 : 396
Jena, Thüringer Universitats- und
Landesbibliothek
Bose q. 19 : 325, 330, 332-333
Karlsruhe, Badische Landesbibliothek
Aug. perg. 253 : 88
Fragm. Aug. 8 : 524-525
Karlsr. 504 : 325, 331,333
Klosterneuburg, Stiftsbibliothek
131 :407
161 : 383
638 : 383
777 : 383
809 : 383
1037:383
1074 : 407
1243 : 383
Köln, Erzbischöfliche Diözesan- und
Dombibliothek
63 :55
65 : 55
67: 55
97:55
104 : 55
Köln, Historisches Archiv der Stadt
GB f° 181 : 282
La Spezia, Archivio Notarile Distrettuale
Framm. dantesco : 165,167
der zitierten Handschriften
557
Laon, Bibliothèque municipale
444 : 225
Le Havre, Bibliothèque municipale
332 : 235-236, 241
Le Mans, Bibliothèque municipale
23 : 234, 237-238
99 : 234, 236, 241
216 : 69,234-235, 237-238
228 : 234, 237
Leiden, Universiteitsbibliotheek
BPL 45 A : 71
BPL 67-1: 225
Voss. lat. F 48 : 203, 225
Voss. lat. F 74 : 214
Voss. lat. F 113 : 215
Voss. lat. Q 15 : 235
Voss. lat. Q 86 : 215
Leipzig, Universitätsbibliothek
Lat. 72 : 70
Leipzig, Universitätsbibliothek - London,
British Library - Sankt-Peterburg,
Rossijskaja nacional’naja biblioteka - Sinai,
Monî tis Agias Ekaterinis
Codex Sinaiticus : 85-86
Liège, Bibliothèque de PUniversité
75 : 283
96 : 280
193:282
193 C : 63
195 : 282
220 C : 69
348 C : 70
Lille, Bibliothèque municipale
481 : 70
617:68
London, British Library
Add.11695 : 71
Add. 15107: 65
Add. 16411 : 168
Add. 17742 : 68
Add. 18345 : 385
Add. 21616 : 70
Add. 23935 : 248,250-255, 257-258
Add. 28106 : 67
Add. 33416 : 65
Add. 38604 : 72
Add. 40107 : 82
Add. 43725 : Siehe Leipzig,
Universitätsbibliothek et ah, Codex
Sinaiticus
Arundel 155 : 299-300
Codex Sinaiticus : Siehe Add. 43725 und
Leipzig, Universitätsbibliothek et al.
Cotton Claudius С VI : 299, 301
Cotton Faustina В VI : 299
Cotton Nero С IX : 299
Cotton Tiberius В VIII : 299, 303, 308
Harley 2485 : 67
Harley 2735 : 204, 206,215,217, 220-221
Harley 2736:210, 230
Harley 3049 : 68
Harley 3099 : 63
Harley 3174 : 72
Harley 5598 : 385
Royal 1 A XX : 64
Royal 7 E VI : 299, 301, 307
London, Lambeth Palace Library
3 : 300
46:68
Lucca, Archivio diocesano, Fondo Capitolare
CC 4 : 123
Lucca, Biblioteca Capitolare Feliniana
2 : 121
24 : 121, 123
25 : 121,123
40 : 121, 123
41 : 121,123
47 : 122,123
68 : 121,497, 503
85 : 122-123
124 : 121-122
606 : 122
Passionano C : 113, 121
Passionano P+ : 122-123
Luxembourg, Bibliothèque nationale
264 : 63
558
Verzeichnis
Lyon, Bibliothèque municipale
245 : 68
Madrid, Archivo Histórico Nacional
1097 B: 52
Universidades, car. 22, n° 10 ; 192
Diversos, Mesta, 235, n° 27 : 192,196
Madrid, Biblioteca Nacional
692 : 191,196
10146 : 192
Osuna é Infantado 42 : 66
Vitr. 7-17 : 192,196
Vitr. 23,3 : 165,167
Maidstone, Maidstone Muséum
R 5 : 300
Manchester, John Rylands Library
Lat. 29-31 : 68
Melk, Stiftsbibliothek
412:203-204,208
Metz, Bibliothèque municipale
45:71
46:71
133:71
333 : 71
510 : 64
Milano, Archivio Storico Cívico e Biblioteca
Trivulziana
692 : 65
1077: 165,167
1080 : 165-166
Milano, Biblioteca Ambrosiana
A 40 inf. : 65
B 71 sup. : 203, 217
D 43 inf. : 168
F 205 inf. : 82
Milano, Biblioteca Nazionale Braidense
АС.ХІП.41 : 165,167
Modena, Archivio di Stato
Letterati b. 17 : 165-166
Montecassino, Archivio delPAbbazia
Exultet 2:115
Montpellier, Bibliothèque interuniversitaire,
Section Médecine
H 179 :451
München, Bayerische Staatsbibliothek
Clm 2534 : 404
Cim 6233 : 57
Clm 6256 : 71
Clm 6274 : 55
Clm 6297:55
Clm 6372 : 71
Clm 6382 : 55
Clm 6388 : 61
Clm 6421 : 61
Clm 6432 : 386
Clm 7960 : 385
Clm 13001 : 497
Clm 13092 : 388
Clm 14095 : 388
Clm 14098 : 521
Clm 14437 : 71
Clm 14653 : 60
Clm 14965b : 331
Clm 17177: 386
Clm 18779 : 69
Clm 19456 : 72
Clm 23043 : 66
Hebr. 95 : 385
Münster, Universitätsbibliothek
366 : 66
Müstair, Stiftsarchiv
XVIII 9 : 66
New Haven, Beinecke Library
Marston 112 : 58
New York, Pierpont Morgan Library
M.289 :165,167
M.676 : 143,166
M.737: 112
der zitierten Handschriften
559
Nonantola, Archivio del Comune Padova, Biblioteca Antoniana
Framm. s.s. : 165 378 : 65
Nürnberg, Germanisches Nationalmuseum
Mm 362-371 (früher Praha, Chrâm Раппу
Marie Snežne OFM Ni 3) : 412
Mm 372-388 : 415
Orléans, Bibliothèque municipale
84 : 234
87: 234
162 : 209
191 : 234
229 : 234, 237
270 : 234
313 : 208
322 : 236, 239, 241
338 : 234
Oxford, All Souls College
94 : 168
Oxford, Bodleian Library
Auct. D.4.13 : 64
Auct. E. inf. 1-2 : 300
Bodley 362 : 67
Can. Ital. 50 : 65
Can. Liturg. 345 : 128
Can. Mise. 435 inf. : 65
Can. Mise. 58.01: 168
Can. Pal. Lat. 176 : 64
Holkham Mise. 19 : 128
Lat. th. d.l : 63
Laud Lat. 92 : 315, 317-318, 322-323
Laud Lat. 102 : 313-314
Laud Lat. 108 : 314-316, 322-323, Farbtafel 1
Laud Mise. 124 : 319
Laud Mise. 126 : 309-311, 315
Laud Mise. 129 : 309
Laud Mise. 139 : 318—320
Laud Mise. 256 : 316, 318-319, 321, 323
Laud Mise. 415 : 66
Laud Mise. 436 : 315-317, 320, 322
Laud Mise. 442 : 309
Rawlinson G 134 : 70
Oxford, Exeter College
69 : 69
Paris, Bibliothèque de l’Arsenal
286 : 72
302 : 439-455, 457, 459, 461, 463-465
308 : 443
319 : 443-444
413 : 289
987: 443
1080 : 64
5059 : 64
Paris, Bibliothèque Mazarine
922 : 69
1641 : 238
Paris, Bibliothèque nationale de France
Esp. 36 : 192, 196
Esp. 217 : 65
Ital. 528 : 165
Ital. 543 : 165
Ital. 591 : 147-148, 156,166
Lat. 266 : 234
Lat. 944 : 235-236
Lat. 1118:234
Lat. 1231 : 235, 240
Lat. 1257 : 208
Lat. 1258 : 208
Lat. 1548 : 234
Lat. 1821 : 202
Lat. 1824 : 204
Lat, 1836 : 207
Lat. 1845 : 128
Lat. 1978 : 234
Lat, 2099 : 443
Lat. 2208 : 236
Lat. 2278 : 209, 230
Lat, 2312 : 209
Lat. 2342: 238
Lat. 2373 : 207
Lat. 2394 : 203, 207
Lat. 2395 : 203
Lat. 2683 : 202
Lat. 2831 : 64
Lat, 2873A : 204
Lat. 3686 : 235
Lat. 3785 : 234, 238-239
Lat. 3786 : 70, 234, 237, 241
Lat. 4404 : 61
Lat. 4410 : 55
560
Verzeichnis
Lat. 5071 : 234-236,241-242
Lat. 5253 : 235, 238, 241
Lat. 5296A : 234
Lat. 5568 : 55
Lat. 5716:204, 206, 228
Lat. 5725 : 214, 223
Lat. 5730 : 177
Lat. 6370 : 220
Lat. 7230A : 204,206,209,222,228
Lat. 7231 : 235
Lat. 7496 : 52, 204, 217-221, 225
Lat. 7501 : 225
Lat. 7581 : 207
Lat. 7584:203,207,211
Lat. 7665 : 207
Lat. 7926 : 207, 229
Lat. 7960 : 204-205, 209
Lat. 8687 : 168
Lat. 8884 : 247
Lat. 8912 : 63
Lat. 8922 : 63
Lat. 8960 : 63
Lat. 9392 : 240
Lat. 9431 : 234, 236, 239, 241
Lat. 9435 : 234, 240
Lat. 9448 : 72
Lat. 9449 : 234-235,237
Lat. 9518 : 238, 241
Lat. 9528 : 63
Lat. 9568 : 63
Lat. 9666 : 63
Lat. 10500 : 240
Lat. 10758:211
Lat. 10848 : 234
Lat. 11550:236, 241
Lat. 11589 : 236, 239
Lat. 11590:235,237
Lat. 11751 : 236, 241
Lat. 12048 : 51
Lat. 12054:234,237-238
Lat. 12117:235
Lat. 12171 : 55, 450
Lat. 12172 : 450
Lat. 12173 : 450
Lat. 12174 : 450
Lat. 12175 : 450
Lat. 12176 : 450
Lat. 12177 : 450
Lat. 12178 : 450
Lat. 12179 : 450
Lat. 12180:450
Lat. 12181 : 450
Lat. 12182 : 450
Lat. 12183 : 450
Lat. 12219 : 240
Lat. 12225 : 237
Lat. 12268 : 237
Lat. 12297 : 235-236, 238, 240
Lat. 12445:211
Lat. 12495 : 236, 241
Lat. 12601 : 235, 238, 240,242
Lat. 12610 : 241
Lat. 12949 : 216
Lat. 13090:211
Lat. 13220:235
Lat. 13345 : 204
Lat. 13358 : 204
Lat. 13764:211
Lat. 13833 : 55
Lat. 13875 : 236, 241-242
Lat. 15176 : 236, 242
Lat. 15381 : 406
Lat. 15392 : 239-240
Lat. 16025 : 204
Lat. 17275:234, 242
Lat. 17333 : 234, 236, 241
Lat. 17448 : 204
Lat. 17742 : 234-235, 239, 242
N. a. lat. 638 : 236, 241-242
N. a. lat. 1447 : 234, 239, 242
N. a. lat. 1452 : 234, 242
N. a. lat. 1457 : 207
N. a. lat. 1496 : 236, 241
N. a. lat. 1548 : 60, 234, 236, 239-240,242
N. a. lat. 1615:208, 229
N. a. lat. 1622 : 203
N. a. lat. 1631 : 55
N. a. lat. 2247 : 235, 239, 242
Paris, Bibliothèque Sainte-Geneviève
267 : 64
Paris, Ecole des Beaux-Arts, Coll. J. Masson
13 : 67
Parma, Biblioteca Palatina
Parm. 3285 : 165,167
Pavia, Biblioteca Universitaria
249 : 65
Pisa, Archivio di Stato
Diplomatico Atti Pubblici, 1139 luglio 19 : 116
der zitierten Handschriften
561
Pisa, Archivio Diocesano
Fondo Arcivescovile, 275 : 11,124
Fondo Capitolare, Exultet 1 : 113—116, 125
Fondo Zucchelli, B237 : 112
Pisa, Biblioteca capitolare
148 : 112
Pisa, Biblioteca Universitaria
628 : 66
702 : 112
Pisa, Opera del Duomo
Exultet 2 : 113-115
Exultet 3 : 113
Pistoia, Archivio Capitolare
C.96 : 135
C.101 : 137-138
C.105 : 137
C.l 09 : 131, 133, 135
C.115 : 128-131,133-137,139
C.122 : 137
C.125 : 131,135,137
C.127 : 131,135
C.130 : 131
C.132 : 135,137
C.135 : 135
C.137: 131,137
C.140 : 131,135-136
C.141 : 131,135
C.l 56 : 131, 135
C.157 : 131
C.158 : 131-133
C.160 : 131
C.161 : 131
C. l64 : 128
D. 22 : 129
L.8 : 129
Framm. 6 : 131, 137
Framm. 28 : 131
Framm. 40 : 131-132
Framm. 45 : 131-132
Pistoia, Archivio Vescovile
III.R.66 : 129
Pistoia, Biblioteca comunale Forteguerriana
A. 45 : 155-156,168
Praha, Chrám Panny Marie Sněžné OFM
Ni 1 : 412
Ni 2 : 412
Ni 3 (heute Nürnberg, Germanisches
Nationalmuseum Mm 362-371): 412
Ni 4 (heute Privatbesitz): 412
Ni 6 : 412
Praha, Knihovna Metropolitní kapituly
1465 : 65
Praha, Knihovna Národního Muzea
XVIIA 2 : 413
XVII D 25 : 333
Praha, Národní Archiv
ŘF 3231 :412-113
ŘF, Kn. č. 267: 412-413
Praha, Státní oblastní archiv ~ Kutná Hora,
Státní okresní archiv
Kn. č. 372 : 415
Quedlinburg, Stiftskirche
S.n. : 82
Quimper, Bibliothèque municipale
16:236, 241
Ravenna, Museo Arcivescovile
S.n. (NT, Fragm.): 88
S.n. (Passio s. Agapii, Fragm.): 88
Reggio Emilia, Archivio di Stato
Framm. s.s. : 165
Reims, Bibliothèque municipale
15:234, 237-238
101 : 55
294 : 236-237
295 : 236-238
385:211
390:211
392:211
393 : 211
425:211
477 : 65
1402 : 236-238
562
Verzeichnis
Rein, Stiftsbibliothek
42 : 388
Roma, Biblioteca Casanatense
716 : 128
717:128
718 : 128
719 : 128
720 : 128
721 : 128
Roma, Biblioteca Nazionale Centrale
Sessoriano 55 (2099) : 87
Vitt.Em. 1189 : 166
Roma, Biblioteca Valliceliiana
79 : 121
81 : 121
Roma, Santa Sabina (Biblioteca della Curia
generalizia)
XIV L 1 : 248,250-251,253-254,256-257
Rouen, Bibliothèque municipale
103 : 236
135 : 236,238,240-241
150 : 234,236,238,240
233 : 236,238
272 : 236, 241
273 : 236, 238
310 : 241
395 : 234, 238,241
421 : 234, 236,238
425 : 236
427 : 241
428 : 236, 238
440 : 234,236, 238, 241
441 : 236, 240
446 : 234, 236, 238, 244
447 : 234, 236, 238
454:236, 238
458 :236,238
459 : 234,236,238
460:236, 238
468 : 241
475 : 236, 238, 241
477 : 237-238
479 : 236, 238,241
485 : 236, 238
489 : 236, 241
497:236,238
516:236, 238
528 : 239
531 : 234
538 : 234, 236,238
1123 : 236, 238
1126:236
1173 : 236, 238,241
1331 : 240
1333 : 236,238-239,241
1378 : 234
1383 : 238, 241
1400 : 241
1405 : 237-238
1406 : 235, 237-238
1408 : 234,236, 238
1409 : 234,236,238-239, 244
Suppl. 116 : 236, 238, 240
Saint-Omer, Bibliothèque municipale
91 : 55
112 : 70
Salamanca, San Esteban
SAL.-CL.01 : 249-256
Salzburg, Erzabtei St. Peter
A XI14 : 450
A VII 26 : 400
San Gimignano, Biblioteca comunale
4 : 118
Sankt Gallen, Stiftsarchiv
dass. I, Cist. c 3, B 55 : 53
Sankt Gallen, Stiftsbibliothek
14 : 366
17 : 372-373
53 : 365, 368-369, Farbtafel 2, Farbtafel 3
56 : 521-522, 524, 528
78 : 91
163 : 450
177 : 203
207 : 55
208 : 55
209 : 55
267: 365
390:2,4
876 : 437
der zitierten Handschriften
563
904 : 521, 524
914 : 536
1092 : 17,23, 51, 358-362, 364, 373
1394 : 81
Sankt-Peterburg, Rossijskaja Nacional’naja
Bibliotēka
F IV 65 : 70
Codex Sinaiticus : Siehe Leipzig,
Universitätsbibliothek et al.
Saumur, Bibliothèque municipale
15 : 240
Savona, Archivio di Stato
Framm. s.s. : 165
Schaffhausen, Stadtbibliothek
Min. 1 : 351
Min. 2 : 352
Min. 3 : 352
Min. 4 : 344, 352, 354
Min. 11 : 344-345, 350-351,354, Farbtafel 4
Min. 15 : 345, 351, 353
Min. 16 : 345, 350-351, Farbtafel 5
Min. 17:343,345, 351
Min. 18 : 344-345, 351-352, 354
Min. 19 : 345, 351
Min. 41 : 350-351
Min. 55 : 344
Min. 56 : 350
Sevilla, Archivo de la Catedral
Sece. I (Secretaría), 1. 07423 : 193
Sece. II (Mesa Capitular), 1. 08732 : 194
Sece. II (Mesa Capitular), 1. 09138 : 182,184,
186, 188-189, 196
Sece. V (Patronatos), 1. 09750 : 182,184,
188-191
Sece. V (Patronatos), 1. 09755 : 196
Sece. IX (Fondo Histórico General), 1.10939 :
194
Sece. IX (Fondo Histórico General), 1.10946 :
189
Sece. IX (Fondo Histórico General), 1.10951 :
192, 196
Sece. IX (Fondo Histórico General), 1. 10963 :
194
Sece. IX (Fondo Histórico General), 1. 10968 :
192
Siena, Biblioteca comunale degli Intronati
C.III.25 : 166
Siena, Biblioteca privata Domenico Maffei
Framm. danteschi s.s. : 165,167
Sinai, Moní tis Agias Ekaterínis
Codex Sinaiticus : Siehe Leipzig,
Universitätsbibliothek et al.
Todi, Biblioteca comunale Lorenzo Leoni
1 : 493-495,499, 501-502,505,510-511,516
2 : 492-495,499, 501-502,504, 510-511,516
Toledo, Archivo municipal
Fondo Cabildo de Jurados, n°48 : 191-192,
196
Tournus, Bibliothèque municipale
1 : 236, 239
Tours, Bibliothèque municipale
90 : 235, 241
196 : 239
887:203
Třeboň, Státní oblastní archiv
RA Černínů Jindřichův Hradec, ms. 2 : 413
Trento, Castello del Buonconsiglio
1589 : 82
Trier, Stadtbibliothek
475 : 69
Trnave, Spolok svätého Vojtecha
Fasc. 20 Nr. 15 : 423
Troyes, Médiathèque du Grand Troyes
(Médiathèque de ľAgglomération,
Bibliothèque municipale)
40, t. 4 : 450-451,457,459,461,463
105 : 450
450 : 406
504 : 88
1499 : 64
564
Verzeichnis
Utrecht, Universiteitsbibliotheek
97:70
Vendôme, Bibliothèque municipale
181 : 69
203 : 236
Venezia, Biblioteca Nazionale Marciana
It. I 3 (4889) : 64
Lat. Ili 38 (2619) : 73
Lat.VI 109 : 168
Lat. XIII 68 : 168
Lat. XIII 69 : 168
Z.51 : 165,167
Z.55 : 165
Venezia, Museo Correr
C.2070/VIL4 : 165, 167
Verdun, Bibliothèque municipale
2:239
7:236
10 : 235
1009 : 240
Verona, Biblioteca Capitolare
1(1): 88
IV (4) : 88
XXII (20) : 88
XXVIII (26) : 176-177
XXIX (27) : 176-178
XXX (28) : 177,179
XXXI (29) : 177, 179
XXXIII (31): 178
XXXVI (34) : 177,180
XXXVIII (36) : 87,172
LIII (51) : 87
LIX (57) : 87
LXXXV (80) : 87
Volterra, Biblioteca Guarnacci
XLV6.8 : 118
XLVI.3.9 : 118
XLVIII.2.3 : 117
L.3.39 : 117,125
LL4.17: 118, 126
LVT.6.14 : 118
LXI.8.1 : 118
LXI.8.2 : 118
LXL8.3 : 118
LXI.8.4 : 118
LXI.8.5 : 118
LXI.8.6 : 118
LXI.8.7 (1) : 118
Wertheim am Main, Evangelische
Kirchenbibliothek
708 : 450
Wertheim am Main, Staatsarchiv
Fragm.2 : 315-316, 322
Wien, Österreichische Nationalbibliothek
Med.gr. 1 : 83, 85
15 : 81
240 : 392,401,407
378 : 393
400 : 392-393
420 : 467-487
496 : 429
539 : 392-393, 396
542 : 392
662: 427
715 : 393,398
719 : 392
800 : 393
819 : 383
830 : 392, 400
948 : 393,401-403,407
974 : 392, 403-405, 407
1046 : 392,398,400
1050 : 388
1098 : 393
1182: 70
1418:393, 405,407
1508 : 393
1550 : 393
1569 : 393, 405-407
1580 : 392
1599 : 393
1624 : 393
2177: 394
2340 : 392
2400 : 393
2425 : 393
2503 : 392
2687 : 525-526
4812 : 427
4893 : 392
der zitierten Handschriften
565
Mus. 15493 : 413
Mus. 15494 : 413
Wien, Schottenkloster
21 : 450
Wolfenbüttel, Herzog August Bibliothek
Aug. 2° 36.32 : 82
Heimst. 842 : 316
Weiss. 92 : 60
Wrocław, Biblioteka Uniwersytecka
I F 433 : 416
IF 437: 416
IF 438 : 416
Würzburg, Universitätsbibliothek
M.p.th.f.3 :311
M.p.th.f.6 : 316, 320
M.p.th.f.14 : 317
M.p.th.f.18 : 317
M.p.th.f.40 : 310,316,320
M.p.th.f.65 : 318, 320
M.p.th.f.66 : 318
M.p.th.f.69 : 315
M.p.th.f.72 : 315, 318, 322
M.p.th.f.74 : 319
M.p.th.f.144 : 312,314-315, 322
M.p.th.f.146 : 309
M.p.th.f.147: 317
M.p.th.f.175 : 309
M.p.th.f.l81 : 314-315, 322
M.p.th.f.184 : 314-315, 322
M.p.th.q.25: 312, 315-316
Zürich, Zentralbibliothek
C 78 : 340
Car. C 11 : 450
Zwettl, Stiftsbibliothek
231 : 403
357: 407
Sine loco:
Cassiodorus, Privatbesitz (Verkauf Sotheby’s 18.
Juni 2002, Nr. 38): 207
Graduale Fragm., Privatbesitz (früher Praha,
Chrám Panny Marie Sněžné OFM Ni 4) :
412
Verzeichnis der Papyri
Charga, Museum Al Wadi El Gedid
P. Kellis III Gr. 95 : 77
Co LOGNY, Bibliotheca Bodmeriana
P. Bodmer V+X+XI+VII+XIII+XII+XX+IX+VIII:
79
P. Bodmer XXIX+XXX-XXXVIII: 79
Hamburg, Staats- und Universitätsbibliothek
P. Hamb. bil. 1 : 80
Kairo, Koptisches Museum
Inv. Nr. 4851,10544-10555,10589,11597,
11640 (Codici di Nag Hammadi) : 79
London, British Library
P. Lond. Lit. 108 : 77
Napoli, Biblioteca nazionale
P. Here. 1419 + 1074B + 1677A + 1081B +
1676 + 994 : 76
P. Here. 1669 : 76
P Here. 1670 : 77
Oxford, Säckler Library
R Oxy. 2092 : 77
Inhalt
Vorwort der Herausgeber
Andreas Nievergelt / Rudolf Gamper 9
Premessa
Stefano Zamponi 11
Le Scriptorium. Nature - Fonctions · Spécificités
Denis Muzerelle 15
Einleitung
Martin Steinmann 17
Grundlegende Fragen
A la (re-)découverte des scriptoria français. L’apport du « Catalogue des
manuscrits datés »
Denis Muzerelle 25
Can a Scriptorium Always be Identified by its Products?
David Ganz 51
Mentions de scriptoria dans les colophons: les mots et les réalités
Lucien Reynhout 63
Prima dello scriptorium. Esperienze di produzione libraria ‘collettiva’
in età tardoantica
Paolo Fioretti 75
Panorama der Schreiborte
La produzione dei libri nella Congregazione di Vallombrosa. Un’indagine
sui manoscritti più antichi (sec. XI - prima metà del sec. XII)
Rosa Marulo 93
Scrivere nelle cattedrali della Toscana occidentale tra XI e XII secolo.
Spunti per una ricerca
Andrea Puglia
109
6
Inhalt
La produzione documentaria e libraria nella canônica di San Zeno
di Pistoia (sec. XI ex.-XII in.)
Michaelangiola Marchiaro 127
Scriptoria e cancellerie nella Firenze del XIV secolo
Irene Ceccherini / Teresa De Robertis 141
Lo scriptorium delia cattedrale di Verona attraverso 1’analisi dei manoscritti
delle opere di sant’Agostino
Donatella Tronca 171
Administración y escritura en la catedral de Sevilla:
Libros entre el control y la memória
Diego Belmonte Fernandez 181
Y a-t-il eu un scriptorium à Auxerre au temps d’Heiric (841-v. 876)?
Charlotte Denoël / Franck Cinato 199
L’évolution de l’écriture au XIe siècle en France: le cas des scriptoria
de Cluny, d’Angers et de Jumièges
Maria Gurrado 231
The Dominican Scriptorium at Saint-Jacques, and its Production
of Liturgical Exemplars
Eleanor Giraud 247
The Gembloux Scriptorium in the Eleventh Century
Robert Gary Babcock / Albert Derolez 259
Entre le scriptorium et la cella: production communautaire et copie
individuelle dans les monastères de l’ordre des croisiers au XVe siècle
Xavier Hermand 275
Script, Book Production and the Practice of the Rule at Christ Church,
Canterbury in the Mid Twelfth Century
Teresa Webber 295
German Anglo-Saxon Minuscule in Würzburg
Daniela Mairhofer 309
Quos manu sua pene omnes ipse scripsit: Frutolf of Michelsberg’s
Legacy to a Bamberg Scriptorium
Thomas John Henry McCarthy
325
Inhalt
7
Handschriften und Inschriften des 11./12. Jahrhunderts aus dem Kloster
Allerheiligen in Schaffhausen
Marina Bernasconi Reusser
Das Scriptorium im frühmittelalterlichen Kloster St. Gallen. Bedeutung und
Organisation nach den literarischen Zeugnissen
Ernst Tremp
Die Suche nach dem archimedischen Punkt. Methodische Probleme der
Erforschung von Scriptorien und Buchproduktion im
12. Jahrhundert am Beispiel von Admont
Christoph Egger
Neu identifizierte Heiligenkreuzer Handschriften in der Österreichischen
Nationalbihliothek
Katharina Kaska
Schreiben und Scriptoria in den Klöstern der Franziskaner-Observanten
in Böhmen am Ende des 15. und am Anfang des 16. Jahrhunderts
Hana Pátková
Handschriftenproduktion im mittelalterlichen Pressburg / Bratislava.
Gab es dort ein Scriptorium?
Juraj Šedivý
Paläographisch-kodikologische Einzelstudien
Organisation du scriptorium et correction des textes d’après les
Enarrationes in Psalmos de l’abbaye cistercienne de Fontenay
(Paris, Bibliothèque nationale de France, Arsenal, ms. 302)
Dominique Stutzmann
Beobachtungen zur Arbeitsweise der Schreiber des Passionale,
Wien, ÖNB, Cod. 420
Herrad Spilling
Fast and Slow Books and Finisher Scribes: Discerning Patterns of Scribal
Work in Italian Giant Bibles and Moralia Manuscripts
Lila Yawn
339
357
375
391
409
419
439
467
489
8
Inhalt
Written Apart and Written Together: Placing Spaces in Old Irish
and Old High German
Dagmar Bronner / Nathanael Busch 519
In memoriam Albert Bruckner
Albert Bruckner
Martin Steinmann 533
Albert Bruckner et ses « Scriptoria Medii Aevi Helvetica »
Beat von Scarpatetti 543
Anhang
Abkürzungen 549
Verzeichnis der zitierten Handschriften 551
Abbildungsverzeichnis 567
Farbtafeln
573
|
| any_adam_object | 1 |
| author2 | Nievergelt, Andreas 1957- Gamper, Rudolf 1949- Bernasconi, Marina 1958- Ebersperger, Birgit Tremp, Ernst 1948- |
| author2_role | edt edt edt edt edt |
| author2_variant | a n an r g rg m b mb b e be e t et |
| author_GND | (DE-588)1053240643 (DE-588)124306519 (DE-588)12454617X (DE-588)1050689763 (DE-588)142971278 |
| author_facet | Nievergelt, Andreas 1957- Gamper, Rudolf 1949- Bernasconi, Marina 1958- Ebersperger, Birgit Tremp, Ernst 1948- |
| building | Verbundindex |
| bvnumber | BV042560695 |
| classification_rvk | AM 50000 AM 50200 AN 17900 |
| ctrlnum | (OCoLC)927154715 (DE-599)DNB1069865400 |
| dewey-full | 940 |
| dewey-hundreds | 900 - History & geography |
| dewey-ones | 940 - History of Europe |
| dewey-raw | 940 |
| dewey-search | 940 |
| dewey-sort | 3940 |
| dewey-tens | 940 - History of Europe |
| discipline | Allgemeines Geschichte |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>03610nam a22006738c 4500</leader><controlfield tag="001">BV042560695</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20171201 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">150515s2015 gw a||| |||| 10||| ger d</controlfield><datafield tag="015" ind1=" " ind2=" "><subfield code="a">15,N18</subfield><subfield code="2">dnb</subfield></datafield><datafield tag="016" ind1="7" ind2=" "><subfield code="a">1069865400</subfield><subfield code="2">DE-101</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783769610918</subfield><subfield code="c">Gb. : ca. EUR 148.00 (DE), ca. EUR 152.20 (AT), ca. sfr 206.00 (freier Pr.)</subfield><subfield code="9">978-3-7696-1091-8</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3769610911</subfield><subfield code="9">3-7696-1091-1</subfield></datafield><datafield tag="024" ind1="3" ind2=" "><subfield code="a">9783769610918</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)927154715</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)DNB1069865400</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">ger</subfield><subfield code="a">ita</subfield><subfield code="a">fre</subfield><subfield code="a">eng</subfield><subfield code="a">spa</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">gw</subfield><subfield code="c">XA-DE-BY</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-29</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-M100</subfield><subfield code="a">DE-12</subfield><subfield code="a">DE-Re5</subfield><subfield code="a">DE-B496</subfield><subfield code="a">DE-355</subfield><subfield code="a">DE-22</subfield><subfield code="a">DE-384</subfield><subfield code="a">DE-188</subfield><subfield code="a">DE-20</subfield><subfield code="a">DE-Y3</subfield><subfield code="a">DE-B220</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">940</subfield><subfield code="2">23</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">AM 50000</subfield><subfield code="0">(DE-625)4333:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">AM 50200</subfield><subfield code="0">(DE-625)4335:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">AN 17900</subfield><subfield code="0">(DE-625)5808:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">940</subfield><subfield code="2">sdnb</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">8</subfield><subfield code="2">ssgn</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Scriptorium</subfield><subfield code="b">Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013</subfield><subfield code="c">herausgegeben von Andreas Nievergelt, Rudolf Gamper, Marina Bernasconi Reusser, Birgit Ebersperger, Ernst Tremp</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">München</subfield><subfield code="b">Bayerische Akademie der Wissenschaften</subfield><subfield code="c">[2015]</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">München</subfield><subfield code="b">C.H. Beck</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">© 2015</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">584 Seiten</subfield><subfield code="b">Illustrationen, Diagramme, Karten</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">Veröffentlichungen der Kommission für die Herausgabe der mittelalterlichen Bibliothekskataloge Deutschlands und der Schweiz</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">Beiträge teilweise deutsch, teilweise englisch, teilweise französisch, teilweise italienisch, teilweise spanisch mit Abstracts in englischer Sprache</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Schreibschule</subfield><subfield code="0">(DE-588)4131378-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Handschriftenproduktion</subfield><subfield code="0">(DE-588)4398738-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="y">2013</subfield><subfield code="z">Sankt Gallen</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Handschriftenproduktion</subfield><subfield code="0">(DE-588)4398738-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Schreibschule</subfield><subfield code="0">(DE-588)4131378-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Nievergelt, Andreas</subfield><subfield code="d">1957-</subfield><subfield code="0">(DE-588)1053240643</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Gamper, Rudolf</subfield><subfield code="d">1949-</subfield><subfield code="0">(DE-588)124306519</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Bernasconi, Marina</subfield><subfield code="d">1958-</subfield><subfield code="0">(DE-588)12454617X</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Ebersperger, Birgit</subfield><subfield code="0">(DE-588)1050689763</subfield><subfield code="4">edt</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Tremp, Ernst</subfield><subfield code="d">1948-</subfield><subfield code="0">(DE-588)142971278</subfield><subfield code="4">edt</subfield></datafield><datafield tag="710" ind1="2" ind2=" "><subfield code="a">Bayerische Akademie der Wissenschaften</subfield><subfield code="0">(DE-588)2005521-3</subfield><subfield code="4">isb</subfield></datafield><datafield tag="710" ind1="2" ind2=" "><subfield code="a">Comité International de Paléographie Latine</subfield><subfield code="e">Sonstige</subfield><subfield code="0">(DE-588)5169533-9</subfield><subfield code="4">oth</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="u">https://www.recensio.net/r/de9499acfffe4caabc54d54f5a1f5c8b</subfield><subfield code="y">rezensiert in: Quellen und Forschungen aus italienischen Archiven und Bibliotheken, 97 (2017), S. 454-455</subfield><subfield code="3">Rezension</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027994397&sequence=000005&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027994397&sequence=000006&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Register // Gemischte Register</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="n">DHB</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">DHB_BSB_GNDPERS_I</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-027994397</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">745.6</subfield><subfield code="e">22/bsb</subfield></datafield><datafield tag="942" ind1="1" ind2="1"><subfield code="c">907.2</subfield><subfield code="e">22/bsb</subfield></datafield></record></collection> |
| genre | (DE-588)1071861417 Konferenzschrift 2013 Sankt Gallen gnd-content |
| genre_facet | Konferenzschrift 2013 Sankt Gallen |
| id | DE-604.BV042560695 |
| illustrated | Illustrated |
| indexdate | 2024-07-10T01:24:56Z |
| institution | BVB |
| institution_GND | (DE-588)2005521-3 (DE-588)5169533-9 |
| isbn | 9783769610918 3769610911 |
| language | German Italian French English Spanish |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-027994397 |
| oclc_num | 927154715 |
| open_access_boolean | |
| owner | DE-29 DE-19 DE-BY-UBM DE-M100 DE-12 DE-Re5 DE-BY-UBR DE-B496 DE-355 DE-BY-UBR DE-22 DE-BY-UBG DE-384 DE-188 DE-20 DE-Y3 DE-B220 |
| owner_facet | DE-29 DE-19 DE-BY-UBM DE-M100 DE-12 DE-Re5 DE-BY-UBR DE-B496 DE-355 DE-BY-UBR DE-22 DE-BY-UBG DE-384 DE-188 DE-20 DE-Y3 DE-B220 |
| physical | 584 Seiten Illustrationen, Diagramme, Karten |
| psigel | DHB_BSB_GNDPERS_I |
| publishDate | 2015 |
| publishDateSearch | 2015 |
| publishDateSort | 2015 |
| publisher | Bayerische Akademie der Wissenschaften C.H. Beck |
| record_format | marc |
| series2 | Veröffentlichungen der Kommission für die Herausgabe der mittelalterlichen Bibliothekskataloge Deutschlands und der Schweiz |
| spelling | Scriptorium Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013 herausgegeben von Andreas Nievergelt, Rudolf Gamper, Marina Bernasconi Reusser, Birgit Ebersperger, Ernst Tremp München Bayerische Akademie der Wissenschaften [2015] München C.H. Beck © 2015 584 Seiten Illustrationen, Diagramme, Karten txt rdacontent n rdamedia nc rdacarrier Veröffentlichungen der Kommission für die Herausgabe der mittelalterlichen Bibliothekskataloge Deutschlands und der Schweiz Beiträge teilweise deutsch, teilweise englisch, teilweise französisch, teilweise italienisch, teilweise spanisch mit Abstracts in englischer Sprache Schreibschule (DE-588)4131378-1 gnd rswk-swf Handschriftenproduktion (DE-588)4398738-2 gnd rswk-swf (DE-588)1071861417 Konferenzschrift 2013 Sankt Gallen gnd-content Handschriftenproduktion (DE-588)4398738-2 s DE-604 Schreibschule (DE-588)4131378-1 s Nievergelt, Andreas 1957- (DE-588)1053240643 edt Gamper, Rudolf 1949- (DE-588)124306519 edt Bernasconi, Marina 1958- (DE-588)12454617X edt Ebersperger, Birgit (DE-588)1050689763 edt Tremp, Ernst 1948- (DE-588)142971278 edt Bayerische Akademie der Wissenschaften (DE-588)2005521-3 isb Comité International de Paléographie Latine Sonstige (DE-588)5169533-9 oth https://www.recensio.net/r/de9499acfffe4caabc54d54f5a1f5c8b rezensiert in: Quellen und Forschungen aus italienischen Archiven und Bibliotheken, 97 (2017), S. 454-455 Rezension Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027994397&sequence=000005&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis Digitalisierung BSB Muenchen - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027994397&sequence=000006&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA Register // Gemischte Register |
| spellingShingle | Scriptorium Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013 Schreibschule (DE-588)4131378-1 gnd Handschriftenproduktion (DE-588)4398738-2 gnd |
| subject_GND | (DE-588)4131378-1 (DE-588)4398738-2 (DE-588)1071861417 |
| title | Scriptorium Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013 |
| title_auth | Scriptorium Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013 |
| title_exact_search | Scriptorium Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013 |
| title_full | Scriptorium Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013 herausgegeben von Andreas Nievergelt, Rudolf Gamper, Marina Bernasconi Reusser, Birgit Ebersperger, Ernst Tremp |
| title_fullStr | Scriptorium Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013 herausgegeben von Andreas Nievergelt, Rudolf Gamper, Marina Bernasconi Reusser, Birgit Ebersperger, Ernst Tremp |
| title_full_unstemmed | Scriptorium Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013 herausgegeben von Andreas Nievergelt, Rudolf Gamper, Marina Bernasconi Reusser, Birgit Ebersperger, Ernst Tremp |
| title_short | Scriptorium |
| title_sort | scriptorium wesen funktion eigenheiten comite international de paleographie latine xviii kolloquium st gallen 11 14 september 2013 |
| title_sub | Wesen, Funktion, Eigenheiten : Comité international de paléographie latine: XVIII. Kolloquium, St. Gallen 11.–14. September 2013 |
| topic | Schreibschule (DE-588)4131378-1 gnd Handschriftenproduktion (DE-588)4398738-2 gnd |
| topic_facet | Schreibschule Handschriftenproduktion Konferenzschrift 2013 Sankt Gallen |
| url | https://www.recensio.net/r/de9499acfffe4caabc54d54f5a1f5c8b http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027994397&sequence=000005&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=027994397&sequence=000006&line_number=0002&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT nievergeltandreas scriptoriumwesenfunktioneigenheitencomiteinternationaldepaleographielatinexviiikolloquiumstgallen1114september2013 AT gamperrudolf scriptoriumwesenfunktioneigenheitencomiteinternationaldepaleographielatinexviiikolloquiumstgallen1114september2013 AT bernasconimarina scriptoriumwesenfunktioneigenheitencomiteinternationaldepaleographielatinexviiikolloquiumstgallen1114september2013 AT eberspergerbirgit scriptoriumwesenfunktioneigenheitencomiteinternationaldepaleographielatinexviiikolloquiumstgallen1114september2013 AT trempernst scriptoriumwesenfunktioneigenheitencomiteinternationaldepaleographielatinexviiikolloquiumstgallen1114september2013 AT bayerischeakademiederwissenschaften scriptoriumwesenfunktioneigenheitencomiteinternationaldepaleographielatinexviiikolloquiumstgallen1114september2013 AT comiteinternationaldepaleographielatine scriptoriumwesenfunktioneigenheitencomiteinternationaldepaleographielatinexviiikolloquiumstgallen1114september2013 |