Space in tense: the interaction of tense, aspect, evidentiality and speech acts in Korean
Saved in:
Main Author: | |
---|---|
Format: | Book |
Language: | English |
Published: |
Amsterdam [u.a.]
Benjamins
2012
|
Series: | Linguistik aktuell
189 |
Subjects: | |
Online Access: | Inhaltsverzeichnis |
Physical Description: | X, 292 S. |
ISBN: | 9789027255723 9789027273802 |
Staff View
MARC
LEADER | 00000nam a2200000zcb4500 | ||
---|---|---|---|
001 | BV040355894 | ||
003 | DE-604 | ||
005 | 20121008 | ||
007 | t | ||
008 | 120808s2012 ne |||| 00||| eng d | ||
010 | |a 2012012719 | ||
020 | |a 9789027255723 |c alk. paper |9 978-90-272-5572-3 | ||
020 | |a 9789027273802 |c eb |9 978-90-272-7380-2 | ||
035 | |a (OCoLC)812215260 | ||
035 | |a (DE-599)BVBBV040355894 | ||
040 | |a DE-604 |b ger |e aacr | ||
041 | 0 | |a eng | |
044 | |a ne |c NL | ||
049 | |a DE-19 |a DE-12 | ||
050 | 0 | |a PL921 | |
082 | 0 | |a 495.7/5 | |
100 | 1 | |a Chung, Kyung-Sook |e Verfasser |4 aut | |
245 | 1 | 0 | |a Space in tense |b the interaction of tense, aspect, evidentiality and speech acts in Korean |c by Kyung-Sook Chung |
264 | 1 | |a Amsterdam [u.a.] |b Benjamins |c 2012 | |
300 | |a X, 292 S. | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
490 | 1 | |a Linguistik aktuell |v 189 | |
650 | 4 | |a Korean language |x Tense | |
650 | 4 | |a Korean language |x Deixis | |
650 | 4 | |a Korean language |x Aspect | |
650 | 4 | |a Korean language |x Semantics | |
650 | 0 | 7 | |a Sprechakt |0 (DE-588)4077747-9 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Tempus |0 (DE-588)4059446-4 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Raum |0 (DE-588)4048561-4 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Koreanisch |0 (DE-588)4131502-9 |2 gnd |9 rswk-swf |
689 | 0 | 0 | |a Koreanisch |0 (DE-588)4131502-9 |D s |
689 | 0 | 1 | |a Tempus |0 (DE-588)4059446-4 |D s |
689 | 0 | 2 | |a Raum |0 (DE-588)4048561-4 |D s |
689 | 0 | 3 | |a Sprechakt |0 (DE-588)4077747-9 |D s |
689 | 0 | |5 DE-604 | |
830 | 0 | |a Linguistik aktuell |v 189 |w (DE-604)BV000003638 |9 189 | |
856 | 4 | 2 | |m HEBIS Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=025209856&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
999 | |a oai:aleph.bib-bvb.de:BVB01-025209856 |
Record in the Search Index
_version_ | 1804149394848612352 |
---|---|
adam_text | Space in Tense
The interaction of tense, aspect, evidentiality
and speech acts in Korean
Kyung-Sook Chung
Pusan National University
John Benjamins Publishing Company
Amsterdam / Philadelphia
Table of contents
Acknowledgments xi
List of tables xm
List of figures xv
Abbreviations xvn
CHAPTER 1
Introduction 1
1 1 Goals of the investigation 1
1 2 Theoretical assumptions concerning tense, aspect, and eventuality 2
121 Tense as deixis i
iii The referential theory of tense 5
123 Reference time 6
124 Eventualities and the event argument 7
125 Aspect as operators 8
126 Perfect as an operator tense denoting anteriority 9
1 3 Predicative suffixes in Korean 12
1 4 Organization of the book 16
CHAPTER 2
Deictic and non-deictic tenses in Korean 21
2 1 The simple form -ess 11
211 Previous analyses 22
2111 Perfective analyses 22
2112 Past tense approaches 29
2113 Ambiguous between past and perfect 31
212 -Ess as an anterior (perfect) 32
2 2 The double form -essess 35
221 Previous analyses 36
2211 Pluperfect approaches 36
2212 Past tense plus experiential-contrastive aspect 38
2213 Discontinuous past tense 40
222 -Essess as a past tense 42
VIII Space in Tense
2 3 The semantics of -essess versus -ess: Deictic versus non-deictic 47
2 4 Conclusion 54
CHAPTER 3
Semantics and pragmatics of the perfect (anterior) 55
3 1 Semantics of the perfect 55
311 Different readings of the perfect 56
312 The relation between the semantics of the perfect and the
present 62
3 2 Pragmatics of the perfect 68
321 The perfect, discourse topic, and current relevance 68
322 Current relevance and the presupposition of the perfect 72
3 3 The present perfect puzzle 77
331 Rethinking the P-Definiteness Constraint 80
332 Another puzzle: Exceptions to the Deictic
T-Adverbial Constraint 82
3 4 Conclusion 86
CHAPTER 4
Spatial deictic tense 89
4 1 The suffix -te 90
411 Past imperfective approaches 91
412 Evidential approaches 95
4121 Constraints on -te 95
4122 The suffix -te is not an evidential marker 99
413 -Te as a spatial deictic tense 102
4131 Faller s (2004) speaker s perceptual field
and spatio-temporal deictic tense 102
4132 The speaker of -te is a passive perceiver 105
4133 -Te is the spatial deictic past tense 111
4 2 -Ney as the spatial deictic present tense 116
4 3 Conclusion 121
CHAPTER 5
Evidentials in Korean 12s
5 1 Evidential typology 125
5 2 True evidentiality and quasi-evidentiality 128
5 3 The spatial deictic tense and evidentials 132
531 Evidentials: -ess, -keyss, and - 0 133
5311 Defining the evidential meanings 134
Table of contents ix
5312 Implementing the evidential meanings 137
5313 Presupposition of the evidentials 140
532 Modal meanings of the inferential indirect evidentials 146
5321 Indirect evidentials and epistemic modality 146
5322 Izvorski s analysis of the indirect evidential 148
5323 Semantics of the indirect evidential 153
533 Modality in the definition of evidentials 157
5 4 Reportative evidentials 159
541 Reportative forms: -tanta (-tay) and -tatela (-tatey) 160
5411N -K Kim s (2000) analysis 160
5412 Hearsay vs Second-hand 162
542 Reportative versus non-reportative evidentials 166
543 Reportative evidentials are illocutionary operators 170
5431 Interaction with propositional operators 171
5432 (In)felicity if embedded proposition
is known to be false 173
5-4-3-3 (In)felicity if embedded proposition
is known to be true 176
5434 Assent/dissent 178
5435 Embedability 181
5436 Readings in interrogatives 188
5 5 Conclusion 196
CHAPTER 6
Evidential vs non-evidential sentences 199
6 1 Faller s (2002) speech act of presentation 200
6 2 Korean evidential sentences lack assertive points 202
6 3 An analysis of the Korean evidential mode 210
6 4 Portner s (2006) presented set approach 216
6 5 Korean evidentials and subjectivity 219
6 6 Conclusion 223
CHAPTER 7
Conclusions and further issues 227
7 1 Spatial deictic tenses and world variables 230
7 2 Evidentiality and subjective epistemic modality 232
7 3 Syntactic structures of evidential vs non-evidential sentences 243
7 4 Tense and aspect 251
741 Imperfective 252
742 Progressive and resultative 257
x Space in Tense
7 5 Tense interpretation in subordinate clauses 262
751 Imperfective and de se (simultaneous) interpretation 263
752 Deictic tense and the Sequence of Tense phenomenon 265
753 Are there indexicals that can shift the context? 271
7 6 Conclusion 274
Bibliography 277
Author index 285
Language index 287
Subject index 289
|
any_adam_object | 1 |
author | Chung, Kyung-Sook |
author_facet | Chung, Kyung-Sook |
author_role | aut |
author_sort | Chung, Kyung-Sook |
author_variant | k s c ksc |
building | Verbundindex |
bvnumber | BV040355894 |
callnumber-first | P - Language and Literature |
callnumber-label | PL921 |
callnumber-raw | PL921 |
callnumber-search | PL921 |
callnumber-sort | PL 3921 |
callnumber-subject | PL - Eastern Asia, Africa, Oceania |
ctrlnum | (OCoLC)812215260 (DE-599)BVBBV040355894 |
dewey-full | 495.7/5 |
dewey-hundreds | 400 - Language |
dewey-ones | 495 - Languages of east and southeast Asia |
dewey-raw | 495.7/5 |
dewey-search | 495.7/5 |
dewey-sort | 3495.7 15 |
dewey-tens | 490 - Other languages |
discipline | Außereuropäische Sprachen und Literaturen |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01883nam a2200505zcb4500</leader><controlfield tag="001">BV040355894</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20121008 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">120808s2012 ne |||| 00||| eng d</controlfield><datafield tag="010" ind1=" " ind2=" "><subfield code="a">2012012719</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789027255723</subfield><subfield code="c">alk. paper</subfield><subfield code="9">978-90-272-5572-3</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9789027273802</subfield><subfield code="c">eb</subfield><subfield code="9">978-90-272-7380-2</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)812215260</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV040355894</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">aacr</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">ne</subfield><subfield code="c">NL</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-19</subfield><subfield code="a">DE-12</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">PL921</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">495.7/5</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Chung, Kyung-Sook</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Space in tense</subfield><subfield code="b">the interaction of tense, aspect, evidentiality and speech acts in Korean</subfield><subfield code="c">by Kyung-Sook Chung</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Amsterdam [u.a.]</subfield><subfield code="b">Benjamins</subfield><subfield code="c">2012</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">X, 292 S.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Linguistik aktuell</subfield><subfield code="v">189</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Korean language</subfield><subfield code="x">Tense</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Korean language</subfield><subfield code="x">Deixis</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Korean language</subfield><subfield code="x">Aspect</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Korean language</subfield><subfield code="x">Semantics</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Sprechakt</subfield><subfield code="0">(DE-588)4077747-9</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Tempus</subfield><subfield code="0">(DE-588)4059446-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Raum</subfield><subfield code="0">(DE-588)4048561-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Koreanisch</subfield><subfield code="0">(DE-588)4131502-9</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Koreanisch</subfield><subfield code="0">(DE-588)4131502-9</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Tempus</subfield><subfield code="0">(DE-588)4059446-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Raum</subfield><subfield code="0">(DE-588)4048561-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Sprechakt</subfield><subfield code="0">(DE-588)4077747-9</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Linguistik aktuell</subfield><subfield code="v">189</subfield><subfield code="w">(DE-604)BV000003638</subfield><subfield code="9">189</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HEBIS Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=025209856&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-025209856</subfield></datafield></record></collection> |
id | DE-604.BV040355894 |
illustrated | Not Illustrated |
indexdate | 2024-07-10T00:22:20Z |
institution | BVB |
isbn | 9789027255723 9789027273802 |
language | English |
lccn | 2012012719 |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-025209856 |
oclc_num | 812215260 |
open_access_boolean | |
owner | DE-19 DE-BY-UBM DE-12 |
owner_facet | DE-19 DE-BY-UBM DE-12 |
physical | X, 292 S. |
publishDate | 2012 |
publishDateSearch | 2012 |
publishDateSort | 2012 |
publisher | Benjamins |
record_format | marc |
series | Linguistik aktuell |
series2 | Linguistik aktuell |
spelling | Chung, Kyung-Sook Verfasser aut Space in tense the interaction of tense, aspect, evidentiality and speech acts in Korean by Kyung-Sook Chung Amsterdam [u.a.] Benjamins 2012 X, 292 S. txt rdacontent n rdamedia nc rdacarrier Linguistik aktuell 189 Korean language Tense Korean language Deixis Korean language Aspect Korean language Semantics Sprechakt (DE-588)4077747-9 gnd rswk-swf Tempus (DE-588)4059446-4 gnd rswk-swf Raum (DE-588)4048561-4 gnd rswk-swf Koreanisch (DE-588)4131502-9 gnd rswk-swf Koreanisch (DE-588)4131502-9 s Tempus (DE-588)4059446-4 s Raum (DE-588)4048561-4 s Sprechakt (DE-588)4077747-9 s DE-604 Linguistik aktuell 189 (DE-604)BV000003638 189 HEBIS Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=025209856&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
spellingShingle | Chung, Kyung-Sook Space in tense the interaction of tense, aspect, evidentiality and speech acts in Korean Linguistik aktuell Korean language Tense Korean language Deixis Korean language Aspect Korean language Semantics Sprechakt (DE-588)4077747-9 gnd Tempus (DE-588)4059446-4 gnd Raum (DE-588)4048561-4 gnd Koreanisch (DE-588)4131502-9 gnd |
subject_GND | (DE-588)4077747-9 (DE-588)4059446-4 (DE-588)4048561-4 (DE-588)4131502-9 |
title | Space in tense the interaction of tense, aspect, evidentiality and speech acts in Korean |
title_auth | Space in tense the interaction of tense, aspect, evidentiality and speech acts in Korean |
title_exact_search | Space in tense the interaction of tense, aspect, evidentiality and speech acts in Korean |
title_full | Space in tense the interaction of tense, aspect, evidentiality and speech acts in Korean by Kyung-Sook Chung |
title_fullStr | Space in tense the interaction of tense, aspect, evidentiality and speech acts in Korean by Kyung-Sook Chung |
title_full_unstemmed | Space in tense the interaction of tense, aspect, evidentiality and speech acts in Korean by Kyung-Sook Chung |
title_short | Space in tense |
title_sort | space in tense the interaction of tense aspect evidentiality and speech acts in korean |
title_sub | the interaction of tense, aspect, evidentiality and speech acts in Korean |
topic | Korean language Tense Korean language Deixis Korean language Aspect Korean language Semantics Sprechakt (DE-588)4077747-9 gnd Tempus (DE-588)4059446-4 gnd Raum (DE-588)4048561-4 gnd Koreanisch (DE-588)4131502-9 gnd |
topic_facet | Korean language Tense Korean language Deixis Korean language Aspect Korean language Semantics Sprechakt Tempus Raum Koreanisch |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=025209856&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
volume_link | (DE-604)BV000003638 |
work_keys_str_mv | AT chungkyungsook spaceintensetheinteractionoftenseaspectevidentialityandspeechactsinkorean |