Stories of transformative leadership in the human services: why the glass is always full
Saved in:
Main Authors: | , |
---|---|
Format: | Book |
Language: | English |
Published: |
Thousand Oaks, Calif. [u.a.]
Sage Publ.
2010
|
Subjects: | |
Online Access: | Inhaltsverzeichnis |
Item Description: | Includes bibliographical references (p. 265-267) and index |
Physical Description: | XIX, 273 S. ill. 22 cm |
ISBN: | 9781412970167 1412970164 9781412970174 1412970172 |
Staff View
MARC
LEADER | 00000nam a2200000 c 4500 | ||
---|---|---|---|
001 | BV036502912 | ||
003 | DE-604 | ||
005 | 20100803 | ||
007 | t | ||
008 | 100615s2010 xxua||| |||| 00||| eng d | ||
010 | |a 2008045848 | ||
020 | |a 9781412970167 |c cloth |9 978-1-4129-7016-7 | ||
020 | |a 1412970164 |c cloth |9 1-4129-7016-4 | ||
020 | |a 9781412970174 |c pbk. |9 978-1-4129-7017-4 | ||
020 | |a 1412970172 |c pbk. |9 1-4129-7017-2 | ||
035 | |a (OCoLC)705589437 | ||
035 | |a (DE-599)BVBBV036502912 | ||
040 | |a DE-604 |b ger |e aacr | ||
041 | 0 | |a eng | |
044 | |a xxu |c US | ||
049 | |a DE-92 | ||
050 | 0 | |a HM1261 | |
082 | 0 | |a 361.0068/4 | |
084 | |a CW 4600 |0 (DE-625)19179: |2 rvk | ||
100 | 1 | |a Burghardt, Steve |e Verfasser |4 aut | |
245 | 1 | 0 | |a Stories of transformative leadership in the human services |b why the glass is always full |c Steve Burghardt and Willie Tolliver |
264 | 1 | |a Thousand Oaks, Calif. [u.a.] |b Sage Publ. |c 2010 | |
300 | |a XIX, 273 S. |b ill. |c 22 cm | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
500 | |a Includes bibliographical references (p. 265-267) and index | ||
650 | 4 | |a Führung | |
650 | 4 | |a Leadership |z United States | |
650 | 4 | |a Human services |z United States | |
650 | 0 | 7 | |a Führung |0 (DE-588)4018776-7 |2 gnd |9 rswk-swf |
651 | 4 | |a USA | |
689 | 0 | 0 | |a Führung |0 (DE-588)4018776-7 |D s |
689 | 0 | |5 DE-604 | |
700 | 1 | |a Tolliver, Willie |e Verfasser |4 aut | |
856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=020425286&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
999 | |a oai:aleph.bib-bvb.de:BVB01-020425286 |
Record in the Search Index
_version_ | 1804143068043018240 |
---|---|
adam_text | Titel: Stories of transformative leadership in the human services
Autor: Burghardt, Steve
Jahr: 2010
CONTENTS
Foreword vii
Introduction ix
Acknowledgments xv
Part I. The Depletion of Value 1
1. A Boring Assignment 3
2. Half-Empty? Half-Full? 5
3. Jack-of-All-Trades 11
4. Running to Catch Up 19
5. The Extra Mile 23
6. Clipping Coupons 29
7. The Assembly Line 35
8. Splashed Water 41
9. Good Grooming 45
10. Salt and Pepper in the Pot 51
11. Good News, Bad News 59
Part II. Creating Abundance 63
12. Popsicle Sticks 65
13. Seeking Illumination 71
14. Casting a Lure 75
15. Mr. TrumbuH s Motto 83
16. The Second Golden Rule 91
17. Clean as You Go 103
18. Carry Your Vision in Your Pocket 111
19. Politeness Doesn t Cost a Cent 117
20. Two Truths 125
21. Take the Cover Off the Book 133
22. Build Your Community and They
Will Come ... Again 143
23. The Crossroads 151
Learning Guide: Reflective Questions for
Discussion and Classroom Integration 152
Part III. A Leadership Model of Personal
and Organizational Transformation 159
Starting Before the Beginning 160
24. If the Work Is Sacred, Then So Are You 163
Commitment to Being 176
From Inner Balance to Outer Energy:
Diet and Exercise 180
25. The Transformative Model 185
The Commitment to Doing 192
26. Carry Your Vision as a Tool 193
Carry Your Vision as a Tool Exercises 200
27. Practicing Patience and Politeness 205
Practicing Patience and Politeness Exercises 212
28. Embracing Diversity 215
Embracing Diversity Exercises 225
Summing Up: The Steps to Embracing
Difference as a Transformative Leader 231
29. Clean as You Go 233
Clean as You Go Exercises 239
30. Building Community 245
Welcome 250
Engagement 251
Participation 253
Citizenship 255
Building Community Exercises 260
References and Books of Note 265
Index 269
About the Authors 273
|
any_adam_object | 1 |
author | Burghardt, Steve Tolliver, Willie |
author_facet | Burghardt, Steve Tolliver, Willie |
author_role | aut aut |
author_sort | Burghardt, Steve |
author_variant | s b sb w t wt |
building | Verbundindex |
bvnumber | BV036502912 |
callnumber-first | H - Social Science |
callnumber-label | HM1261 |
callnumber-raw | HM1261 |
callnumber-search | HM1261 |
callnumber-sort | HM 41261 |
callnumber-subject | HM - Sociology |
classification_rvk | CW 4600 |
ctrlnum | (OCoLC)705589437 (DE-599)BVBBV036502912 |
dewey-full | 361.0068/4 |
dewey-hundreds | 300 - Social sciences |
dewey-ones | 361 - Social problems and services |
dewey-raw | 361.0068/4 |
dewey-search | 361.0068/4 |
dewey-sort | 3361.0068 14 |
dewey-tens | 360 - Social problems and services; associations |
discipline | Soziologie Psychologie |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01737nam a2200469 c 4500</leader><controlfield tag="001">BV036502912</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20100803 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">100615s2010 xxua||| |||| 00||| eng d</controlfield><datafield tag="010" ind1=" " ind2=" "><subfield code="a">2008045848</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781412970167</subfield><subfield code="c">cloth</subfield><subfield code="9">978-1-4129-7016-7</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">1412970164</subfield><subfield code="c">cloth</subfield><subfield code="9">1-4129-7016-4</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781412970174</subfield><subfield code="c">pbk.</subfield><subfield code="9">978-1-4129-7017-4</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">1412970172</subfield><subfield code="c">pbk.</subfield><subfield code="9">1-4129-7017-2</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)705589437</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV036502912</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">aacr</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">xxu</subfield><subfield code="c">US</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-92</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">HM1261</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">361.0068/4</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">CW 4600</subfield><subfield code="0">(DE-625)19179:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Burghardt, Steve</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Stories of transformative leadership in the human services</subfield><subfield code="b">why the glass is always full</subfield><subfield code="c">Steve Burghardt and Willie Tolliver</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Thousand Oaks, Calif. [u.a.]</subfield><subfield code="b">Sage Publ.</subfield><subfield code="c">2010</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XIX, 273 S.</subfield><subfield code="b">ill.</subfield><subfield code="c">22 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references (p. 265-267) and index</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Führung</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Leadership</subfield><subfield code="z">United States</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Human services</subfield><subfield code="z">United States</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Führung</subfield><subfield code="0">(DE-588)4018776-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">USA</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Führung</subfield><subfield code="0">(DE-588)4018776-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Tolliver, Willie</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=020425286&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-020425286</subfield></datafield></record></collection> |
geographic | USA |
geographic_facet | USA |
id | DE-604.BV036502912 |
illustrated | Illustrated |
indexdate | 2024-07-09T22:41:47Z |
institution | BVB |
isbn | 9781412970167 1412970164 9781412970174 1412970172 |
language | English |
lccn | 2008045848 |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-020425286 |
oclc_num | 705589437 |
open_access_boolean | |
owner | DE-92 |
owner_facet | DE-92 |
physical | XIX, 273 S. ill. 22 cm |
publishDate | 2010 |
publishDateSearch | 2010 |
publishDateSort | 2010 |
publisher | Sage Publ. |
record_format | marc |
spelling | Burghardt, Steve Verfasser aut Stories of transformative leadership in the human services why the glass is always full Steve Burghardt and Willie Tolliver Thousand Oaks, Calif. [u.a.] Sage Publ. 2010 XIX, 273 S. ill. 22 cm txt rdacontent n rdamedia nc rdacarrier Includes bibliographical references (p. 265-267) and index Führung Leadership United States Human services United States Führung (DE-588)4018776-7 gnd rswk-swf USA Führung (DE-588)4018776-7 s DE-604 Tolliver, Willie Verfasser aut HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=020425286&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
spellingShingle | Burghardt, Steve Tolliver, Willie Stories of transformative leadership in the human services why the glass is always full Führung Leadership United States Human services United States Führung (DE-588)4018776-7 gnd |
subject_GND | (DE-588)4018776-7 |
title | Stories of transformative leadership in the human services why the glass is always full |
title_auth | Stories of transformative leadership in the human services why the glass is always full |
title_exact_search | Stories of transformative leadership in the human services why the glass is always full |
title_full | Stories of transformative leadership in the human services why the glass is always full Steve Burghardt and Willie Tolliver |
title_fullStr | Stories of transformative leadership in the human services why the glass is always full Steve Burghardt and Willie Tolliver |
title_full_unstemmed | Stories of transformative leadership in the human services why the glass is always full Steve Burghardt and Willie Tolliver |
title_short | Stories of transformative leadership in the human services |
title_sort | stories of transformative leadership in the human services why the glass is always full |
title_sub | why the glass is always full |
topic | Führung Leadership United States Human services United States Führung (DE-588)4018776-7 gnd |
topic_facet | Führung Leadership United States Human services United States USA |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=020425286&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
work_keys_str_mv | AT burghardtsteve storiesoftransformativeleadershipinthehumanserviceswhytheglassisalwaysfull AT tolliverwillie storiesoftransformativeleadershipinthehumanserviceswhytheglassisalwaysfull |