The war in Iraq and why the media failed us:
Answers a key question on the lips of many Americans as violence in Iraq continues and report after report reveals that President Bush's reasons for leading Americans to war were not backed by solid evidence: "Why weren't the media more skeptical during the rush to war?"
Saved in:
Main Author: | |
---|---|
Format: | Book |
Language: | English |
Published: |
Westport, Connecticut ; London
Praeger
2006
|
Subjects: | |
Online Access: | Table of contents Inhaltsverzeichnis |
Summary: | Answers a key question on the lips of many Americans as violence in Iraq continues and report after report reveals that President Bush's reasons for leading Americans to war were not backed by solid evidence: "Why weren't the media more skeptical during the rush to war?" |
Item Description: | Includes bibliographical references (p. [167]-181) and index |
Physical Description: | xiii, 193 Seiten 25 cm |
ISBN: | 0275987663 |
Staff View
MARC
LEADER | 00000nam a2200000zc 4500 | ||
---|---|---|---|
001 | BV021741914 | ||
003 | DE-604 | ||
005 | 20210830 | ||
007 | t | ||
008 | 060924s2006 xxu |||| 00||| eng d | ||
010 | |a 2006015086 | ||
015 | |a GBA642346 |2 dnb | ||
020 | |a 0275987663 |c alk. paper |9 0-275-98766-3 | ||
035 | |a (OCoLC)67869940 | ||
035 | |a (DE-599)BVBBV021741914 | ||
040 | |a DE-604 |b ger |e aacr | ||
041 | 0 | |a eng | |
044 | |a xxu |c US | ||
049 | |a DE-12 |a DE-188 |a DE-706 | ||
050 | 0 | |a P96.I732 | |
082 | 0 | |a 070.4/4995670443/0973 | |
100 | 1 | |a Dadge, David |0 (DE-588)1240161182 |4 aut | |
245 | 1 | 0 | |a The war in Iraq and why the media failed us |c David Dadge ; foreword by Danny Schechter |
264 | 1 | |a Westport, Connecticut ; London |b Praeger |c 2006 | |
300 | |a xiii, 193 Seiten |c 25 cm | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
500 | |a Includes bibliographical references (p. [167]-181) and index | ||
520 | 3 | |a Answers a key question on the lips of many Americans as violence in Iraq continues and report after report reveals that President Bush's reasons for leading Americans to war were not backed by solid evidence: "Why weren't the media more skeptical during the rush to war?" | |
650 | 4 | |a Guerre en Irak, 2003- dans la presse - États-Unis | |
650 | 4 | |a Guerre en Irak, 2003- - Médias et guerre | |
650 | 7 | |a Massamedia |2 gtt | |
650 | 7 | |a Oorlog |2 gtt | |
650 | 7 | |a Publieke opinie |2 gtt | |
650 | 4 | |a Medien | |
650 | 4 | |a Iraq War, 2003- |x Mass media and the war | |
650 | 4 | |a Iraq War, 2003- |x Press coverage |z United States | |
650 | 0 | 7 | |a Kriegsberichterstattung |0 (DE-588)4033120-9 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Falschmeldung |0 (DE-588)4294308-5 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Golfkrieg |g 2003 |0 (DE-588)4731075-3 |2 gnd |9 rswk-swf |
651 | 7 | |a Irak |2 gtt | |
651 | 7 | |a Verenigde Staten |2 gtt | |
651 | 4 | |a USA | |
651 | 7 | |a USA |0 (DE-588)4078704-7 |2 gnd |9 rswk-swf | |
689 | 0 | 0 | |a USA |0 (DE-588)4078704-7 |D g |
689 | 0 | 1 | |a Golfkrieg |g 2003 |0 (DE-588)4731075-3 |D s |
689 | 0 | 2 | |a Kriegsberichterstattung |0 (DE-588)4033120-9 |D s |
689 | 0 | 3 | |a Falschmeldung |0 (DE-588)4294308-5 |D s |
689 | 0 | |5 DE-604 | |
856 | 4 | |u http://www.loc.gov/catdir/toc/ecip0613/2006015086.html |3 Table of contents | |
856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=014955265&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
999 | |a oai:aleph.bib-bvb.de:BVB01-014955265 |
Record in the Search Index
_version_ | 1804135594380492800 |
---|---|
adam_text | Titel: The war in Iraq and why the media failed us
Autor: Dadge, David
Jahr: 2006
CONTENTS
Foreword by Danny Schechter
Acknowledgments
Introduction
1. The Road to Awe
2. When President Bites Watchdog
3. Dissent and Patriotism: The Arm s Length Principle
4. All Quiet on the Home Front
5. The Prison, the General, and the Flexible Broadcaster
6. Concentrating on Bias
7. Mea Pulpa
8. Reintroducing the Skeptic s Test
Conclusion
Notes
Bibliography
Index
|
adam_txt |
Titel: The war in Iraq and why the media failed us
Autor: Dadge, David
Jahr: 2006
CONTENTS
Foreword by Danny Schechter
Acknowledgments
Introduction
1. The Road to Awe
2. When President Bites "Watchdog"
3. Dissent and Patriotism: The Arm's Length Principle
4. All Quiet on the Home Front
5. The Prison, the General, and the Flexible Broadcaster
6. Concentrating on Bias
7. Mea Pulpa
8. Reintroducing the Skeptic's Test
Conclusion
Notes
Bibliography
Index |
any_adam_object | 1 |
any_adam_object_boolean | 1 |
author | Dadge, David |
author_GND | (DE-588)1240161182 |
author_facet | Dadge, David |
author_role | aut |
author_sort | Dadge, David |
author_variant | d d dd |
building | Verbundindex |
bvnumber | BV021741914 |
callnumber-first | P - Language and Literature |
callnumber-label | P96 |
callnumber-raw | P96.I732 |
callnumber-search | P96.I732 |
callnumber-sort | P 296 I732 |
callnumber-subject | P - Philology and Linguistics |
ctrlnum | (OCoLC)67869940 (DE-599)BVBBV021741914 |
dewey-full | 070.4/4995670443/0973 |
dewey-hundreds | 000 - Computer science, information, general works |
dewey-ones | 070 - Documentary, educational, news media; journalism |
dewey-raw | 070.4/4995670443/0973 |
dewey-search | 070.4/4995670443/0973 |
dewey-sort | 270.4 104995670443 3973 |
dewey-tens | 070 - Documentary, educational, news media; journalism |
discipline | Allgemeines |
discipline_str_mv | Allgemeines |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02573nam a2200601zc 4500</leader><controlfield tag="001">BV021741914</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20210830 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">060924s2006 xxu |||| 00||| eng d</controlfield><datafield tag="010" ind1=" " ind2=" "><subfield code="a">2006015086</subfield></datafield><datafield tag="015" ind1=" " ind2=" "><subfield code="a">GBA642346</subfield><subfield code="2">dnb</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0275987663</subfield><subfield code="c">alk. paper</subfield><subfield code="9">0-275-98766-3</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)67869940</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV021741914</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">aacr</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">xxu</subfield><subfield code="c">US</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield><subfield code="a">DE-188</subfield><subfield code="a">DE-706</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">P96.I732</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">070.4/4995670443/0973</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Dadge, David</subfield><subfield code="0">(DE-588)1240161182</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The war in Iraq and why the media failed us</subfield><subfield code="c">David Dadge ; foreword by Danny Schechter</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Westport, Connecticut ; London</subfield><subfield code="b">Praeger</subfield><subfield code="c">2006</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">xiii, 193 Seiten</subfield><subfield code="c">25 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references (p. [167]-181) and index</subfield></datafield><datafield tag="520" ind1="3" ind2=" "><subfield code="a">Answers a key question on the lips of many Americans as violence in Iraq continues and report after report reveals that President Bush's reasons for leading Americans to war were not backed by solid evidence: "Why weren't the media more skeptical during the rush to war?"</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Guerre en Irak, 2003- dans la presse - États-Unis</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Guerre en Irak, 2003- - Médias et guerre</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Massamedia</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Oorlog</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Publieke opinie</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Medien</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Iraq War, 2003-</subfield><subfield code="x">Mass media and the war</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Iraq War, 2003-</subfield><subfield code="x">Press coverage</subfield><subfield code="z">United States</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kriegsberichterstattung</subfield><subfield code="0">(DE-588)4033120-9</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Falschmeldung</subfield><subfield code="0">(DE-588)4294308-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Golfkrieg</subfield><subfield code="g">2003</subfield><subfield code="0">(DE-588)4731075-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Irak</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Verenigde Staten</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">USA</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">USA</subfield><subfield code="0">(DE-588)4078704-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">USA</subfield><subfield code="0">(DE-588)4078704-7</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Golfkrieg</subfield><subfield code="g">2003</subfield><subfield code="0">(DE-588)4731075-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Kriegsberichterstattung</subfield><subfield code="0">(DE-588)4033120-9</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Falschmeldung</subfield><subfield code="0">(DE-588)4294308-5</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2=" "><subfield code="u">http://www.loc.gov/catdir/toc/ecip0613/2006015086.html</subfield><subfield code="3">Table of contents</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=014955265&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-014955265</subfield></datafield></record></collection> |
geographic | Irak gtt Verenigde Staten gtt USA USA (DE-588)4078704-7 gnd |
geographic_facet | Irak Verenigde Staten USA |
id | DE-604.BV021741914 |
illustrated | Not Illustrated |
index_date | 2024-07-02T15:29:38Z |
indexdate | 2024-07-09T20:42:59Z |
institution | BVB |
isbn | 0275987663 |
language | English |
lccn | 2006015086 |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-014955265 |
oclc_num | 67869940 |
open_access_boolean | |
owner | DE-12 DE-188 DE-706 |
owner_facet | DE-12 DE-188 DE-706 |
physical | xiii, 193 Seiten 25 cm |
publishDate | 2006 |
publishDateSearch | 2006 |
publishDateSort | 2006 |
publisher | Praeger |
record_format | marc |
spelling | Dadge, David (DE-588)1240161182 aut The war in Iraq and why the media failed us David Dadge ; foreword by Danny Schechter Westport, Connecticut ; London Praeger 2006 xiii, 193 Seiten 25 cm txt rdacontent n rdamedia nc rdacarrier Includes bibliographical references (p. [167]-181) and index Answers a key question on the lips of many Americans as violence in Iraq continues and report after report reveals that President Bush's reasons for leading Americans to war were not backed by solid evidence: "Why weren't the media more skeptical during the rush to war?" Guerre en Irak, 2003- dans la presse - États-Unis Guerre en Irak, 2003- - Médias et guerre Massamedia gtt Oorlog gtt Publieke opinie gtt Medien Iraq War, 2003- Mass media and the war Iraq War, 2003- Press coverage United States Kriegsberichterstattung (DE-588)4033120-9 gnd rswk-swf Falschmeldung (DE-588)4294308-5 gnd rswk-swf Golfkrieg 2003 (DE-588)4731075-3 gnd rswk-swf Irak gtt Verenigde Staten gtt USA USA (DE-588)4078704-7 gnd rswk-swf USA (DE-588)4078704-7 g Golfkrieg 2003 (DE-588)4731075-3 s Kriegsberichterstattung (DE-588)4033120-9 s Falschmeldung (DE-588)4294308-5 s DE-604 http://www.loc.gov/catdir/toc/ecip0613/2006015086.html Table of contents HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=014955265&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
spellingShingle | Dadge, David The war in Iraq and why the media failed us Guerre en Irak, 2003- dans la presse - États-Unis Guerre en Irak, 2003- - Médias et guerre Massamedia gtt Oorlog gtt Publieke opinie gtt Medien Iraq War, 2003- Mass media and the war Iraq War, 2003- Press coverage United States Kriegsberichterstattung (DE-588)4033120-9 gnd Falschmeldung (DE-588)4294308-5 gnd Golfkrieg 2003 (DE-588)4731075-3 gnd |
subject_GND | (DE-588)4033120-9 (DE-588)4294308-5 (DE-588)4731075-3 (DE-588)4078704-7 |
title | The war in Iraq and why the media failed us |
title_auth | The war in Iraq and why the media failed us |
title_exact_search | The war in Iraq and why the media failed us |
title_exact_search_txtP | The war in Iraq and why the media failed us |
title_full | The war in Iraq and why the media failed us David Dadge ; foreword by Danny Schechter |
title_fullStr | The war in Iraq and why the media failed us David Dadge ; foreword by Danny Schechter |
title_full_unstemmed | The war in Iraq and why the media failed us David Dadge ; foreword by Danny Schechter |
title_short | The war in Iraq and why the media failed us |
title_sort | the war in iraq and why the media failed us |
topic | Guerre en Irak, 2003- dans la presse - États-Unis Guerre en Irak, 2003- - Médias et guerre Massamedia gtt Oorlog gtt Publieke opinie gtt Medien Iraq War, 2003- Mass media and the war Iraq War, 2003- Press coverage United States Kriegsberichterstattung (DE-588)4033120-9 gnd Falschmeldung (DE-588)4294308-5 gnd Golfkrieg 2003 (DE-588)4731075-3 gnd |
topic_facet | Guerre en Irak, 2003- dans la presse - États-Unis Guerre en Irak, 2003- - Médias et guerre Massamedia Oorlog Publieke opinie Medien Iraq War, 2003- Mass media and the war Iraq War, 2003- Press coverage United States Kriegsberichterstattung Falschmeldung Golfkrieg 2003 Irak Verenigde Staten USA |
url | http://www.loc.gov/catdir/toc/ecip0613/2006015086.html http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=014955265&sequence=000004&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
work_keys_str_mv | AT dadgedavid thewariniraqandwhythemediafailedus |