Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island:
Saved in:
Main Authors: | , , |
---|---|
Format: | Book |
Language: | English |
Published: |
Washington, DC
United States Gov. Print. Off.
1980
|
Series: | Geological Survey professional paper / United States Geological Survey
1177-A |
Subjects: | |
Online Access: | Inhaltsverzeichnis |
Physical Description: | 24 S. Ill., graph. Darst., Kt. |
Staff View
MARC
LEADER | 00000nam a2200000 cb4500 | ||
---|---|---|---|
001 | BV017550193 | ||
003 | DE-604 | ||
005 | 20211108 | ||
007 | t | ||
008 | 031002s1980 abd| |||| 00||| eng d | ||
035 | |a (OCoLC)6470064 | ||
035 | |a (DE-599)BVBBV017550193 | ||
040 | |a DE-604 |b ger |e rakwb | ||
041 | 0 | |a eng | |
049 | |a DE-20 |a DE-188 | ||
050 | 0 | |a GB126.M3 | |
050 | 0 | |a QE75.P9 | |
082 | 0 | |a 333.7 |2 19 | |
084 | |a RU 20183 |0 (DE-625)142510:12648 |2 rvk | ||
100 | 1 | |a Dolan, Robert |e Verfasser |4 aut | |
245 | 1 | 0 | |a Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island |c by Robert Dolan, Harry Lins, and John Stewart |
264 | 1 | |a Washington, DC |b United States Gov. Print. Off. |c 1980 | |
300 | |a 24 S. |b Ill., graph. Darst., Kt. | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
490 | 1 | |a Geological Survey professional paper / United States Geological Survey |v 1177-A | |
650 | 4 | |a Cordons littoraux - Maryland - Fenwick Island | |
650 | 4 | |a Barrier islands |z Delaware | |
650 | 4 | |a Barrier islands |z Maryland | |
650 | 4 | |a Physical geography |z Fenwick Island (Del. and Md.) | |
650 | 4 | |a Shore protection |z Fenwick Island (Del. and Md.) | |
651 | 4 | |a Fenwick, Île (Del. et Mar.) | |
651 | 4 | |a Fenwick Island (Del. and Md.) | |
700 | 1 | |a Lins, Harry F. |e Verfasser |4 aut | |
700 | 1 | |a Stewart, John |e Verfasser |4 aut | |
810 | 2 | |a United States Geological Survey |t Geological Survey professional paper |v 1177-A |w (DE-604)BV000005472 |9 1177-A | |
856 | 4 | 2 | |m HEBIS Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010564443&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
999 | |a oai:aleph.bib-bvb.de:BVB01-010564443 |
Record in the Search Index
_version_ | 1804130325389901824 |
---|---|
adam_text | Contents
Foreword 1
Introduction—the coastal zone 2
Barrier islands 3
Dynamic nature of barrier islands 4
Barrier island processes 6
Storms
Waves
Sea level
Barrier island forms 8
Geological history of Fenwick Island 9
History and development of Fenwick Island 10
Recent land use patterns and trends 12
Erosion and storm surge penetration on Fenwick Island 16
Erosion
Storm surge penetration
Engineering works 18
Erosion control
Ocean City Inlet ,
Hazards on barrier islands 20
Federal flood insurance program 22
Summary 23
References and acknowledgments 24
|
any_adam_object | 1 |
author | Dolan, Robert Lins, Harry F. Stewart, John |
author_facet | Dolan, Robert Lins, Harry F. Stewart, John |
author_role | aut aut aut |
author_sort | Dolan, Robert |
author_variant | r d rd h f l hf hfl j s js |
building | Verbundindex |
bvnumber | BV017550193 |
callnumber-first | G - Geography, Anthropology, Recreation |
callnumber-label | GB126 |
callnumber-raw | GB126.M3 QE75.P9 |
callnumber-search | GB126.M3 QE75.P9 |
callnumber-sort | GB 3126 M3 |
callnumber-subject | GB - Physical Geography |
classification_rvk | RU 20183 |
ctrlnum | (OCoLC)6470064 (DE-599)BVBBV017550193 |
dewey-full | 333.7 |
dewey-hundreds | 300 - Social sciences |
dewey-ones | 333 - Economics of land and energy |
dewey-raw | 333.7 |
dewey-search | 333.7 |
dewey-sort | 3333.7 |
dewey-tens | 330 - Economics |
discipline | Wirtschaftswissenschaften Geographie |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01832nam a2200433 cb4500</leader><controlfield tag="001">BV017550193</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20211108 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">031002s1980 abd| |||| 00||| eng d</controlfield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)6470064</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV017550193</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-20</subfield><subfield code="a">DE-188</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">GB126.M3</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">QE75.P9</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">333.7</subfield><subfield code="2">19</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">RU 20183</subfield><subfield code="0">(DE-625)142510:12648</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Dolan, Robert</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island</subfield><subfield code="c">by Robert Dolan, Harry Lins, and John Stewart</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Washington, DC</subfield><subfield code="b">United States Gov. Print. Off.</subfield><subfield code="c">1980</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">24 S.</subfield><subfield code="b">Ill., graph. Darst., Kt.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Geological Survey professional paper / United States Geological Survey</subfield><subfield code="v">1177-A</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Cordons littoraux - Maryland - Fenwick Island</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Barrier islands</subfield><subfield code="z">Delaware</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Barrier islands</subfield><subfield code="z">Maryland</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Physical geography</subfield><subfield code="z">Fenwick Island (Del. and Md.)</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Shore protection</subfield><subfield code="z">Fenwick Island (Del. and Md.)</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">Fenwick, Île (Del. et Mar.)</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">Fenwick Island (Del. and Md.)</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Lins, Harry F.</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Stewart, John</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="810" ind1="2" ind2=" "><subfield code="a">United States Geological Survey</subfield><subfield code="t">Geological Survey professional paper</subfield><subfield code="v">1177-A</subfield><subfield code="w">(DE-604)BV000005472</subfield><subfield code="9">1177-A</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HEBIS Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010564443&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-010564443</subfield></datafield></record></collection> |
geographic | Fenwick, Île (Del. et Mar.) Fenwick Island (Del. and Md.) |
geographic_facet | Fenwick, Île (Del. et Mar.) Fenwick Island (Del. and Md.) |
id | DE-604.BV017550193 |
illustrated | Illustrated |
indexdate | 2024-07-09T19:19:14Z |
institution | BVB |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-010564443 |
oclc_num | 6470064 |
open_access_boolean | |
owner | DE-20 DE-188 |
owner_facet | DE-20 DE-188 |
physical | 24 S. Ill., graph. Darst., Kt. |
publishDate | 1980 |
publishDateSearch | 1980 |
publishDateSort | 1980 |
publisher | United States Gov. Print. Off. |
record_format | marc |
series2 | Geological Survey professional paper / United States Geological Survey |
spelling | Dolan, Robert Verfasser aut Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island by Robert Dolan, Harry Lins, and John Stewart Washington, DC United States Gov. Print. Off. 1980 24 S. Ill., graph. Darst., Kt. txt rdacontent n rdamedia nc rdacarrier Geological Survey professional paper / United States Geological Survey 1177-A Cordons littoraux - Maryland - Fenwick Island Barrier islands Delaware Barrier islands Maryland Physical geography Fenwick Island (Del. and Md.) Shore protection Fenwick Island (Del. and Md.) Fenwick, Île (Del. et Mar.) Fenwick Island (Del. and Md.) Lins, Harry F. Verfasser aut Stewart, John Verfasser aut United States Geological Survey Geological Survey professional paper 1177-A (DE-604)BV000005472 1177-A HEBIS Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010564443&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
spellingShingle | Dolan, Robert Lins, Harry F. Stewart, John Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island Cordons littoraux - Maryland - Fenwick Island Barrier islands Delaware Barrier islands Maryland Physical geography Fenwick Island (Del. and Md.) Shore protection Fenwick Island (Del. and Md.) |
title | Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island |
title_auth | Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island |
title_exact_search | Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island |
title_full | Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island by Robert Dolan, Harry Lins, and John Stewart |
title_fullStr | Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island by Robert Dolan, Harry Lins, and John Stewart |
title_full_unstemmed | Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island by Robert Dolan, Harry Lins, and John Stewart |
title_short | Geographical analysis of Fenwick Island, Maryland, a middle Atlantic coast barrier island |
title_sort | geographical analysis of fenwick island maryland a middle atlantic coast barrier island |
topic | Cordons littoraux - Maryland - Fenwick Island Barrier islands Delaware Barrier islands Maryland Physical geography Fenwick Island (Del. and Md.) Shore protection Fenwick Island (Del. and Md.) |
topic_facet | Cordons littoraux - Maryland - Fenwick Island Barrier islands Delaware Barrier islands Maryland Physical geography Fenwick Island (Del. and Md.) Shore protection Fenwick Island (Del. and Md.) Fenwick, Île (Del. et Mar.) Fenwick Island (Del. and Md.) |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=010564443&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
volume_link | (DE-604)BV000005472 |
work_keys_str_mv | AT dolanrobert geographicalanalysisoffenwickislandmarylandamiddleatlanticcoastbarrierisland AT linsharryf geographicalanalysisoffenwickislandmarylandamiddleatlanticcoastbarrierisland AT stewartjohn geographicalanalysisoffenwickislandmarylandamiddleatlanticcoastbarrierisland |