Fundamentals of family medicine: the family medicine clerkship textbook
Gespeichert in:
| Format: | Buch |
|---|---|
| Sprache: | English |
| Veröffentlicht: |
New York [u.a.]
Springer
1999
|
| Ausgabe: | 2. ed. |
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | XX, 599 S. Ill., graph. Darst. |
| ISBN: | 0387984453 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV014056173 | ||
| 003 | DE-604 | ||
| 005 | 20070312 | ||
| 007 | t | ||
| 008 | 011213s1999 ad|| |||| 00||| eng d | ||
| 020 | |a 0387984453 |9 0-387-98445-3 | ||
| 035 | |a (OCoLC)75941953 | ||
| 035 | |a (DE-599)BVBBV014056173 | ||
| 040 | |a DE-604 |b ger |e rakwb | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-19 | ||
| 050 | 0 | |a RA418.5.F3F86 1998 | |
| 082 | 0 | |a 616 | |
| 245 | 1 | 0 | |a Fundamentals of family medicine |b the family medicine clerkship textbook |c Robert B. Taylor ed. |
| 250 | |a 2. ed. | ||
| 264 | 1 | |a New York [u.a.] |b Springer |c 1999 | |
| 300 | |a XX, 599 S. |b Ill., graph. Darst. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 650 | 7 | |a Allgemeinmedizin - Fallstudiensammlung |2 swd | |
| 650 | 4 | |a Education, Medical | |
| 650 | 4 | |a Family Practice | |
| 650 | 4 | |a Family medicine | |
| 650 | 4 | |a Primary Health Care | |
| 700 | 1 | |a Taylor, Robert B. |d 1936- |e Sonstige |0 (DE-588)130045608 |4 oth | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=009625788&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-009625788 | ||
Datensatz im Suchindex
| _version_ | 1804128916940521472 |
|---|---|
| adam_text | Contents
Preface vii
Notes for the Reader xi
Contributors xvii
1 Principles of Generalist Health Care 1
Robert B. Taylor
2 Clinical Prevention 19
Evan W.Kligman and Frank A. Hale
3 Normal Pregnancy, Labor, and Delivery 57
Joseph E. Scherger and Margaret V.Elizondo
4 Problems of the Newborn and Infant 77
Richard B. Lewan, Bruce Ambuel, and
Robert W.Sander
5 Common Problems of the Elderly 109
James P. Richardson and Aubrey L. Knight
6 Domestic Violence 133
Valerie J. Gilchrist and Ann Garden
7 Headache 146
Anne D. Walling
8 Hypertension 167
Stephen A. Brunton and Rita K. Edwards
9 Sinusitis and Pharyngitis 188
Paul Evans and William F. Miser
10 Viral Infections of the Respiratory Tract 206
George L. Kirkpatrick
ix
11 Otitis Media and Otitis Externa 225
Jo Ann Rosenfeld and Greg Clarity
12 Ischemic Heart Disease 246
Jim Nuovo and Amir Sweha
13 Obstructive Airway Disease 278
Howard Weinberg
14 Gastritis, Esophagitis, and Peptic Ulcer Disease .... 297
Alan M. Adelman and James P. Richardson
15 Urinary Tract Infections 314
Boyd L. Bailey Jr.
16 Vulvovaginitis and Cervicitis 332
Mary Willard
17 Disorders of the Back and Neck 351
Walter L. Calmbach
18 Osteoarthritis 380
Alicia D. Monroe and John B. Murphy
19 Common Dermatoses 389
DanielJ. Van Durme
20 Diabetes Mellitus 413
Charles Kent Smith, John P. Sheehan, and
Margaret M. Ulchaker
21 Human Immunodeficiency Virus Infection and Acquired
Immunodeficiency Syndrome 437
Ronald H. Goldschmidt and Jill J. Legg
22 Anxiety Disorders 458
David A. Katerndahl
23 Depression 480
Rupert R. Goetz, Scott A. Fields, and William L. Tqffler
24 Care of Acute Lacerations 498
Bryan Campbell and George F Snell
25 Athletic Injuries 527
Michael L. Tuggy and Cora Collettc Brenner
26 Care of the Dying Patient 552
Frank Celestino
Index 569
|
| any_adam_object | 1 |
| author_GND | (DE-588)130045608 |
| building | Verbundindex |
| bvnumber | BV014056173 |
| callnumber-first | R - Medicine |
| callnumber-label | RA418 |
| callnumber-raw | RA418.5.F3F86 1998 |
| callnumber-search | RA418.5.F3F86 1998 |
| callnumber-sort | RA 3418.5 F3 F86 41998 |
| callnumber-subject | RA - Public Medicine |
| ctrlnum | (OCoLC)75941953 (DE-599)BVBBV014056173 |
| dewey-full | 616 |
| dewey-hundreds | 600 - Technology (Applied sciences) |
| dewey-ones | 616 - Diseases |
| dewey-raw | 616 |
| dewey-search | 616 |
| dewey-sort | 3616 |
| dewey-tens | 610 - Medicine and health |
| discipline | Medizin |
| edition | 2. ed. |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01298nam a2200361 c 4500</leader><controlfield tag="001">BV014056173</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20070312 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">011213s1999 ad|| |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0387984453</subfield><subfield code="9">0-387-98445-3</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)75941953</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV014056173</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakwb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-19</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">RA418.5.F3F86 1998</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">616</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Fundamentals of family medicine</subfield><subfield code="b">the family medicine clerkship textbook</subfield><subfield code="c">Robert B. Taylor ed.</subfield></datafield><datafield tag="250" ind1=" " ind2=" "><subfield code="a">2. ed.</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">New York [u.a.]</subfield><subfield code="b">Springer</subfield><subfield code="c">1999</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XX, 599 S.</subfield><subfield code="b">Ill., graph. Darst.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Allgemeinmedizin - Fallstudiensammlung</subfield><subfield code="2">swd</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Education, Medical</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Family Practice</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Family medicine</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Primary Health Care</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Taylor, Robert B.</subfield><subfield code="d">1936-</subfield><subfield code="e">Sonstige</subfield><subfield code="0">(DE-588)130045608</subfield><subfield code="4">oth</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=009625788&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-009625788</subfield></datafield></record></collection> |
| id | DE-604.BV014056173 |
| illustrated | Illustrated |
| indexdate | 2024-07-09T18:56:51Z |
| institution | BVB |
| isbn | 0387984453 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-009625788 |
| oclc_num | 75941953 |
| open_access_boolean | |
| owner | DE-19 DE-BY-UBM |
| owner_facet | DE-19 DE-BY-UBM |
| physical | XX, 599 S. Ill., graph. Darst. |
| publishDate | 1999 |
| publishDateSearch | 1999 |
| publishDateSort | 1999 |
| publisher | Springer |
| record_format | marc |
| spelling | Fundamentals of family medicine the family medicine clerkship textbook Robert B. Taylor ed. 2. ed. New York [u.a.] Springer 1999 XX, 599 S. Ill., graph. Darst. txt rdacontent n rdamedia nc rdacarrier Allgemeinmedizin - Fallstudiensammlung swd Education, Medical Family Practice Family medicine Primary Health Care Taylor, Robert B. 1936- Sonstige (DE-588)130045608 oth HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=009625788&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Fundamentals of family medicine the family medicine clerkship textbook Allgemeinmedizin - Fallstudiensammlung swd Education, Medical Family Practice Family medicine Primary Health Care |
| title | Fundamentals of family medicine the family medicine clerkship textbook |
| title_auth | Fundamentals of family medicine the family medicine clerkship textbook |
| title_exact_search | Fundamentals of family medicine the family medicine clerkship textbook |
| title_full | Fundamentals of family medicine the family medicine clerkship textbook Robert B. Taylor ed. |
| title_fullStr | Fundamentals of family medicine the family medicine clerkship textbook Robert B. Taylor ed. |
| title_full_unstemmed | Fundamentals of family medicine the family medicine clerkship textbook Robert B. Taylor ed. |
| title_short | Fundamentals of family medicine |
| title_sort | fundamentals of family medicine the family medicine clerkship textbook |
| title_sub | the family medicine clerkship textbook |
| topic | Allgemeinmedizin - Fallstudiensammlung swd Education, Medical Family Practice Family medicine Primary Health Care |
| topic_facet | Allgemeinmedizin - Fallstudiensammlung Education, Medical Family Practice Family medicine Primary Health Care |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=009625788&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT taylorrobertb fundamentalsoffamilymedicinethefamilymedicineclerkshiptextbook |