Black picket fences: privilege and peril among the Black middle class
"Black Picket Fences is a stark, moving, and candid look at a section of America that is too often ignored by both scholars and the media: the black middle class. After living for three years in "Groveland," a black middle-class neighborhood on Chicago's South Side, sociologist M...
Gespeichert in:
| 1. Verfasser: | |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
Chicago [u.a.]
Univ. of Chicago Press
1999
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Zusammenfassung: | "Black Picket Fences is a stark, moving, and candid look at a section of America that is too often ignored by both scholars and the media: the black middle class. After living for three years in "Groveland," a black middle-class neighborhood on Chicago's South Side, sociologist Mary Pattillo-McCoy writes, "I had seen three groups of eighth-graders graduate to high school, high school kids go on to college, and college graduates start their careers. I also heard too many stories and read too many obituaries of the teenagers who were jailed or killed along the way. The son of a police detective in jail for murder. The grandson of a teacher shot while visiting his girlfriend's house. The daughter of a park supervisor living with a drug dealer who would later be killed at a fast-food restaurant." Both troublesome and hopeful, these are the discontinuities in the daily life of Groveland residents that Pattillo-McCoy seeks to explain." "Despite arguments that race no longer matters, Pattillo-McCoy shows a different reality: Even the black and white middle classes remain separate and unequal."--BOOK JACKET. |
| Beschreibung: | XII, 276 S. |
| ISBN: | 0226649288 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV012912181 | ||
| 003 | DE-604 | ||
| 005 | 20141204 | ||
| 007 | t | ||
| 008 | 991217s1999 |||| 00||| eng d | ||
| 020 | |a 0226649288 |9 0-226-64928-8 | ||
| 035 | |a (OCoLC)40925848 | ||
| 035 | |a (DE-599)BVBBV012912181 | ||
| 040 | |a DE-604 |b ger |e rakddb | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-12 |a DE-11 |a DE-188 | ||
| 050 | 0 | |a F548.9.N4 | |
| 082 | 0 | |a 305.896073077311 |2 21 | |
| 100 | 1 | |a Pattillo, Mary |e Verfasser |0 (DE-588)1062998472 |4 aut | |
| 245 | 1 | 0 | |a Black picket fences |b privilege and peril among the Black middle class |c Mary Pattillo |
| 264 | 1 | |a Chicago [u.a.] |b Univ. of Chicago Press |c 1999 | |
| 300 | |a XII, 276 S. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 520 | 1 | |a "Black Picket Fences is a stark, moving, and candid look at a section of America that is too often ignored by both scholars and the media: the black middle class. After living for three years in "Groveland," a black middle-class neighborhood on Chicago's South Side, sociologist Mary Pattillo-McCoy writes, "I had seen three groups of eighth-graders graduate to high school, high school kids go on to college, and college graduates start their careers. I also heard too many stories and read too many obituaries of the teenagers who were jailed or killed along the way. The son of a police detective in jail for murder. The grandson of a teacher shot while visiting his girlfriend's house. The daughter of a park supervisor living with a drug dealer who would later be killed at a fast-food restaurant." Both troublesome and hopeful, these are the discontinuities in the daily life of Groveland residents that Pattillo-McCoy seeks to explain." "Despite arguments that race no longer matters, Pattillo-McCoy shows a different reality: Even the black and white middle classes remain separate and unequal."--BOOK JACKET. | |
| 650 | 4 | |a African American families | |
| 650 | 4 | |a Classes moyennes - Illinois - Chicago | |
| 650 | 7 | |a Classes moyennes - États-Unis - Chicago (Ill.) - 1970-2000 |2 ram | |
| 650 | 4 | |a Jeunesse noire américaine - Illinois - Chicago - Conditions sociales | |
| 650 | 7 | |a Jeunesse noire américaine - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000 |2 ram | |
| 650 | 4 | |a Middle class families - United States | |
| 650 | 7 | |a Noirs américains - Conditions sociales - 1975-... |2 ram | |
| 650 | 4 | |a Noirs américains - Illinois - Chicago - Conditions sociales | |
| 650 | 4 | |a Noirs américains - Illinois - Chicago - Conditions économiques | |
| 650 | 7 | |a Noirs américains - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000 |2 ram | |
| 650 | 7 | |a Noirs américains - États-Unis - Chicago (Ill.) - Conditions économiques - 1970-2000 |2 ram | |
| 650 | 4 | |a Schwarze. USA | |
| 650 | 4 | |a Wirtschaft | |
| 650 | 4 | |a African American youth |z Illinois |z Chicago |x Social conditions | |
| 650 | 4 | |a African Americans |z Illinois |z Chicago |x Economic conditions | |
| 650 | 4 | |a African Americans |z Illinois |z Chicago |x Social conditions | |
| 650 | 4 | |a Middle class |z Illinois |z Chicago | |
| 650 | 0 | 7 | |a Mittelstand |0 (DE-588)4039713-0 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Soziale Situation |0 (DE-588)4077575-6 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Wirtschaftliche Lage |0 (DE-588)4248362-1 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Schwarze |0 (DE-588)4116433-7 |2 gnd |9 rswk-swf |
| 651 | 4 | |a Chicago (Ill.) - Conditions sociales | |
| 651 | 7 | |a Chicago (Ill.) - Relations interethniques - 1970-2000 |2 ram | |
| 651 | 4 | |a Chicago (Ill.) - Relations raciales | |
| 651 | 4 | |a United States - Race relations | |
| 651 | 4 | |a USA | |
| 651 | 4 | |a Chicago (Ill.) |x Race relations | |
| 651 | 4 | |a Chicago (Ill.) |x Social conditions | |
| 651 | 7 | |a Chicago, Ill. |0 (DE-588)4009921-0 |2 gnd |9 rswk-swf | |
| 689 | 0 | 0 | |a Chicago, Ill. |0 (DE-588)4009921-0 |D g |
| 689 | 0 | 1 | |a Schwarze |0 (DE-588)4116433-7 |D s |
| 689 | 0 | 2 | |a Mittelstand |0 (DE-588)4039713-0 |D s |
| 689 | 0 | 3 | |a Soziale Situation |0 (DE-588)4077575-6 |D s |
| 689 | 0 | 4 | |a Wirtschaftliche Lage |0 (DE-588)4248362-1 |D s |
| 689 | 0 | |8 1\p |5 DE-604 | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008789083&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 883 | 1 | |8 1\p |a cgwrk |d 20201028 |q DE-101 |u https://d-nb.info/provenance/plan#cgwrk | |
| 943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-008789083 | |
Datensatz im Suchindex
| _version_ | 1806055677265707008 |
|---|---|
| adam_text |
CONTENTS
Acknowledgments ix
INTRODUCTION
]
ONE
The Black Middle Class:
Who, When, and Where?
13
TWO
The Making of Groveland
31
THREE
Generations through a Changing Economy
44
FOUR
Neighborhood Networks and Crime
68
FIVE
Growing Up in Groveland
91
vii
CONTENTS / Viil
SIX
In a Ghetto Trance
117
SEVEN
Nike's Reign
146
EIGHT
William "Spider" Waters, Jr.:
Straddling Two Worlds
167
NINE
Typical Terri Jones
186
CONCLUSION
201
Appendix A:
Research Method 219
Appendix B:
Groveland Neighborhood Characteristics 226
Notes 229
References 247
Index 261 |
| any_adam_object | 1 |
| author | Pattillo, Mary |
| author_GND | (DE-588)1062998472 |
| author_facet | Pattillo, Mary |
| author_role | aut |
| author_sort | Pattillo, Mary |
| author_variant | m p mp |
| building | Verbundindex |
| bvnumber | BV012912181 |
| callnumber-first | F - General American History |
| callnumber-label | F548 |
| callnumber-raw | F548.9.N4 |
| callnumber-search | F548.9.N4 |
| callnumber-sort | F 3548.9 N4 |
| callnumber-subject | F - General American History |
| ctrlnum | (OCoLC)40925848 (DE-599)BVBBV012912181 |
| dewey-full | 305.896073077311 |
| dewey-hundreds | 300 - Social sciences |
| dewey-ones | 305 - Groups of people |
| dewey-raw | 305.896073077311 |
| dewey-search | 305.896073077311 |
| dewey-sort | 3305.896073077311 |
| dewey-tens | 300 - Social sciences |
| discipline | Soziologie |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>00000nam a2200000 c 4500</leader><controlfield tag="001">BV012912181</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20141204</controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">991217s1999 |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0226649288</subfield><subfield code="9">0-226-64928-8</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)40925848</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV012912181</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakddb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield><subfield code="a">DE-11</subfield><subfield code="a">DE-188</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">F548.9.N4</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">305.896073077311</subfield><subfield code="2">21</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Pattillo, Mary</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1062998472</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Black picket fences</subfield><subfield code="b">privilege and peril among the Black middle class</subfield><subfield code="c">Mary Pattillo</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Chicago [u.a.]</subfield><subfield code="b">Univ. of Chicago Press</subfield><subfield code="c">1999</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XII, 276 S.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="520" ind1="1" ind2=" "><subfield code="a">"Black Picket Fences is a stark, moving, and candid look at a section of America that is too often ignored by both scholars and the media: the black middle class. After living for three years in "Groveland," a black middle-class neighborhood on Chicago's South Side, sociologist Mary Pattillo-McCoy writes, "I had seen three groups of eighth-graders graduate to high school, high school kids go on to college, and college graduates start their careers. I also heard too many stories and read too many obituaries of the teenagers who were jailed or killed along the way. The son of a police detective in jail for murder. The grandson of a teacher shot while visiting his girlfriend's house. The daughter of a park supervisor living with a drug dealer who would later be killed at a fast-food restaurant." Both troublesome and hopeful, these are the discontinuities in the daily life of Groveland residents that Pattillo-McCoy seeks to explain." "Despite arguments that race no longer matters, Pattillo-McCoy shows a different reality: Even the black and white middle classes remain separate and unequal."--BOOK JACKET.</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">African American families</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Classes moyennes - Illinois - Chicago</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Classes moyennes - États-Unis - Chicago (Ill.) - 1970-2000</subfield><subfield code="2">ram</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Jeunesse noire américaine - Illinois - Chicago - Conditions sociales</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Jeunesse noire américaine - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000</subfield><subfield code="2">ram</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Middle class families - United States</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Noirs américains - Conditions sociales - 1975-...</subfield><subfield code="2">ram</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Noirs américains - Illinois - Chicago - Conditions sociales</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Noirs américains - Illinois - Chicago - Conditions économiques</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Noirs américains - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000</subfield><subfield code="2">ram</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Noirs américains - États-Unis - Chicago (Ill.) - Conditions économiques - 1970-2000</subfield><subfield code="2">ram</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Schwarze. USA</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Wirtschaft</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">African American youth</subfield><subfield code="z">Illinois</subfield><subfield code="z">Chicago</subfield><subfield code="x">Social conditions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">African Americans</subfield><subfield code="z">Illinois</subfield><subfield code="z">Chicago</subfield><subfield code="x">Economic conditions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">African Americans</subfield><subfield code="z">Illinois</subfield><subfield code="z">Chicago</subfield><subfield code="x">Social conditions</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Middle class</subfield><subfield code="z">Illinois</subfield><subfield code="z">Chicago</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Mittelstand</subfield><subfield code="0">(DE-588)4039713-0</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Soziale Situation</subfield><subfield code="0">(DE-588)4077575-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Wirtschaftliche Lage</subfield><subfield code="0">(DE-588)4248362-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Schwarze</subfield><subfield code="0">(DE-588)4116433-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">Chicago (Ill.) - Conditions sociales</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Chicago (Ill.) - Relations interethniques - 1970-2000</subfield><subfield code="2">ram</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">Chicago (Ill.) - Relations raciales</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">United States - Race relations</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">USA</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">Chicago (Ill.)</subfield><subfield code="x">Race relations</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">Chicago (Ill.)</subfield><subfield code="x">Social conditions</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Chicago, Ill.</subfield><subfield code="0">(DE-588)4009921-0</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Chicago, Ill.</subfield><subfield code="0">(DE-588)4009921-0</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Schwarze</subfield><subfield code="0">(DE-588)4116433-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="2"><subfield code="a">Mittelstand</subfield><subfield code="0">(DE-588)4039713-0</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="3"><subfield code="a">Soziale Situation</subfield><subfield code="0">(DE-588)4077575-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="4"><subfield code="a">Wirtschaftliche Lage</subfield><subfield code="0">(DE-588)4248362-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="8">1\p</subfield><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008789083&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="883" ind1="1" ind2=" "><subfield code="8">1\p</subfield><subfield code="a">cgwrk</subfield><subfield code="d">20201028</subfield><subfield code="q">DE-101</subfield><subfield code="u">https://d-nb.info/provenance/plan#cgwrk</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-008789083</subfield></datafield></record></collection> |
| geographic | Chicago (Ill.) - Conditions sociales Chicago (Ill.) - Relations interethniques - 1970-2000 ram Chicago (Ill.) - Relations raciales United States - Race relations USA Chicago (Ill.) Race relations Chicago (Ill.) Social conditions Chicago, Ill. (DE-588)4009921-0 gnd |
| geographic_facet | Chicago (Ill.) - Conditions sociales Chicago (Ill.) - Relations interethniques - 1970-2000 Chicago (Ill.) - Relations raciales United States - Race relations USA Chicago (Ill.) Race relations Chicago (Ill.) Social conditions Chicago, Ill. |
| id | DE-604.BV012912181 |
| illustrated | Not Illustrated |
| indexdate | 2024-07-31T01:21:53Z |
| institution | BVB |
| isbn | 0226649288 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-008789083 |
| oclc_num | 40925848 |
| open_access_boolean | |
| owner | DE-12 DE-11 DE-188 |
| owner_facet | DE-12 DE-11 DE-188 |
| physical | XII, 276 S. |
| publishDate | 1999 |
| publishDateSearch | 1999 |
| publishDateSort | 1999 |
| publisher | Univ. of Chicago Press |
| record_format | marc |
| spelling | Pattillo, Mary Verfasser (DE-588)1062998472 aut Black picket fences privilege and peril among the Black middle class Mary Pattillo Chicago [u.a.] Univ. of Chicago Press 1999 XII, 276 S. txt rdacontent n rdamedia nc rdacarrier "Black Picket Fences is a stark, moving, and candid look at a section of America that is too often ignored by both scholars and the media: the black middle class. After living for three years in "Groveland," a black middle-class neighborhood on Chicago's South Side, sociologist Mary Pattillo-McCoy writes, "I had seen three groups of eighth-graders graduate to high school, high school kids go on to college, and college graduates start their careers. I also heard too many stories and read too many obituaries of the teenagers who were jailed or killed along the way. The son of a police detective in jail for murder. The grandson of a teacher shot while visiting his girlfriend's house. The daughter of a park supervisor living with a drug dealer who would later be killed at a fast-food restaurant." Both troublesome and hopeful, these are the discontinuities in the daily life of Groveland residents that Pattillo-McCoy seeks to explain." "Despite arguments that race no longer matters, Pattillo-McCoy shows a different reality: Even the black and white middle classes remain separate and unequal."--BOOK JACKET. African American families Classes moyennes - Illinois - Chicago Classes moyennes - États-Unis - Chicago (Ill.) - 1970-2000 ram Jeunesse noire américaine - Illinois - Chicago - Conditions sociales Jeunesse noire américaine - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000 ram Middle class families - United States Noirs américains - Conditions sociales - 1975-... ram Noirs américains - Illinois - Chicago - Conditions sociales Noirs américains - Illinois - Chicago - Conditions économiques Noirs américains - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000 ram Noirs américains - États-Unis - Chicago (Ill.) - Conditions économiques - 1970-2000 ram Schwarze. USA Wirtschaft African American youth Illinois Chicago Social conditions African Americans Illinois Chicago Economic conditions African Americans Illinois Chicago Social conditions Middle class Illinois Chicago Mittelstand (DE-588)4039713-0 gnd rswk-swf Soziale Situation (DE-588)4077575-6 gnd rswk-swf Wirtschaftliche Lage (DE-588)4248362-1 gnd rswk-swf Schwarze (DE-588)4116433-7 gnd rswk-swf Chicago (Ill.) - Conditions sociales Chicago (Ill.) - Relations interethniques - 1970-2000 ram Chicago (Ill.) - Relations raciales United States - Race relations USA Chicago (Ill.) Race relations Chicago (Ill.) Social conditions Chicago, Ill. (DE-588)4009921-0 gnd rswk-swf Chicago, Ill. (DE-588)4009921-0 g Schwarze (DE-588)4116433-7 s Mittelstand (DE-588)4039713-0 s Soziale Situation (DE-588)4077575-6 s Wirtschaftliche Lage (DE-588)4248362-1 s 1\p DE-604 HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008789083&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis 1\p cgwrk 20201028 DE-101 https://d-nb.info/provenance/plan#cgwrk |
| spellingShingle | Pattillo, Mary Black picket fences privilege and peril among the Black middle class African American families Classes moyennes - Illinois - Chicago Classes moyennes - États-Unis - Chicago (Ill.) - 1970-2000 ram Jeunesse noire américaine - Illinois - Chicago - Conditions sociales Jeunesse noire américaine - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000 ram Middle class families - United States Noirs américains - Conditions sociales - 1975-... ram Noirs américains - Illinois - Chicago - Conditions sociales Noirs américains - Illinois - Chicago - Conditions économiques Noirs américains - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000 ram Noirs américains - États-Unis - Chicago (Ill.) - Conditions économiques - 1970-2000 ram Schwarze. USA Wirtschaft African American youth Illinois Chicago Social conditions African Americans Illinois Chicago Economic conditions African Americans Illinois Chicago Social conditions Middle class Illinois Chicago Mittelstand (DE-588)4039713-0 gnd Soziale Situation (DE-588)4077575-6 gnd Wirtschaftliche Lage (DE-588)4248362-1 gnd Schwarze (DE-588)4116433-7 gnd |
| subject_GND | (DE-588)4039713-0 (DE-588)4077575-6 (DE-588)4248362-1 (DE-588)4116433-7 (DE-588)4009921-0 |
| title | Black picket fences privilege and peril among the Black middle class |
| title_auth | Black picket fences privilege and peril among the Black middle class |
| title_exact_search | Black picket fences privilege and peril among the Black middle class |
| title_full | Black picket fences privilege and peril among the Black middle class Mary Pattillo |
| title_fullStr | Black picket fences privilege and peril among the Black middle class Mary Pattillo |
| title_full_unstemmed | Black picket fences privilege and peril among the Black middle class Mary Pattillo |
| title_short | Black picket fences |
| title_sort | black picket fences privilege and peril among the black middle class |
| title_sub | privilege and peril among the Black middle class |
| topic | African American families Classes moyennes - Illinois - Chicago Classes moyennes - États-Unis - Chicago (Ill.) - 1970-2000 ram Jeunesse noire américaine - Illinois - Chicago - Conditions sociales Jeunesse noire américaine - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000 ram Middle class families - United States Noirs américains - Conditions sociales - 1975-... ram Noirs américains - Illinois - Chicago - Conditions sociales Noirs américains - Illinois - Chicago - Conditions économiques Noirs américains - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000 ram Noirs américains - États-Unis - Chicago (Ill.) - Conditions économiques - 1970-2000 ram Schwarze. USA Wirtschaft African American youth Illinois Chicago Social conditions African Americans Illinois Chicago Economic conditions African Americans Illinois Chicago Social conditions Middle class Illinois Chicago Mittelstand (DE-588)4039713-0 gnd Soziale Situation (DE-588)4077575-6 gnd Wirtschaftliche Lage (DE-588)4248362-1 gnd Schwarze (DE-588)4116433-7 gnd |
| topic_facet | African American families Classes moyennes - Illinois - Chicago Classes moyennes - États-Unis - Chicago (Ill.) - 1970-2000 Jeunesse noire américaine - Illinois - Chicago - Conditions sociales Jeunesse noire américaine - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000 Middle class families - United States Noirs américains - Conditions sociales - 1975-... Noirs américains - Illinois - Chicago - Conditions sociales Noirs américains - Illinois - Chicago - Conditions économiques Noirs américains - États-Unis - Chicago (Ill.) - Conditions sociales - 1970-2000 Noirs américains - États-Unis - Chicago (Ill.) - Conditions économiques - 1970-2000 Schwarze. USA Wirtschaft African American youth Illinois Chicago Social conditions African Americans Illinois Chicago Economic conditions African Americans Illinois Chicago Social conditions Middle class Illinois Chicago Mittelstand Soziale Situation Wirtschaftliche Lage Schwarze Chicago (Ill.) - Conditions sociales Chicago (Ill.) - Relations interethniques - 1970-2000 Chicago (Ill.) - Relations raciales United States - Race relations USA Chicago (Ill.) Race relations Chicago (Ill.) Social conditions Chicago, Ill. |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=008789083&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT pattillomary blackpicketfencesprivilegeandperilamongtheblackmiddleclass |