The feminine principle in the Sikh vision of the transcendent:
Saved in:
Main Author: | |
---|---|
Format: | Book |
Language: | English |
Published: |
Cambridge u.a.
Cambridge Univ. Press
1993
|
Edition: | 1. publ. |
Series: | Cambridge studies in religious traditions
3 |
Subjects: | |
Online Access: | Inhaltsverzeichnis |
Physical Description: | XII, 318 S. |
ISBN: | 0521432871 |
Staff View
MARC
LEADER | 00000nam a2200000 cb4500 | ||
---|---|---|---|
001 | BV008397954 | ||
003 | DE-604 | ||
005 | 00000000000000.0 | ||
007 | t | ||
008 | 931203s1993 |||| 00||| engod | ||
020 | |a 0521432871 |9 0-521-43287-1 | ||
035 | |a (OCoLC)26303491 | ||
035 | |a (DE-599)BVBBV008397954 | ||
040 | |a DE-604 |b ger |e rakddb | ||
041 | 0 | |a eng | |
049 | |a DE-12 |a DE-473 |a DE-19 | ||
050 | 0 | |a BL2018.5.W65 | |
082 | 0 | |a 294.6/2/082 |2 20 | |
100 | 1 | |a Singh, Nikky-Guninder K. |e Verfasser |4 aut | |
245 | 1 | 0 | |a The feminine principle in the Sikh vision of the transcendent |c Nikky-Guninder Kaur Singh |
250 | |a 1. publ. | ||
264 | 1 | |a Cambridge u.a. |b Cambridge Univ. Press |c 1993 | |
300 | |a XII, 318 S. | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
490 | 1 | |a Cambridge studies in religious traditions |v 3 | |
650 | 7 | |a Sikhs |2 gtt | |
650 | 7 | |a Transcendentie |2 gtt | |
650 | 7 | |a Vrouwelijkheid |2 gtt | |
650 | 4 | |a Religion | |
650 | 4 | |a Femininity (Philosophy) | |
650 | 4 | |a Feminism |x Religious aspects |x Sikhism | |
650 | 4 | |a Sikhism |x Doctrines | |
650 | 4 | |a Women in Sikhism | |
650 | 0 | 7 | |a Frau |0 (DE-588)4018202-2 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Sikhismus |0 (DE-588)4181283-9 |2 gnd |9 rswk-swf |
689 | 0 | 0 | |a Sikhismus |0 (DE-588)4181283-9 |D s |
689 | 0 | 1 | |a Frau |0 (DE-588)4018202-2 |D s |
689 | 0 | |5 DE-604 | |
830 | 0 | |a Cambridge studies in religious traditions |v 3 |w (DE-604)BV004738726 |9 3 | |
856 | 4 | 2 | |m HEBIS Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005532374&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
999 | |a oai:aleph.bib-bvb.de:BVB01-005532374 |
Record in the Search Index
_version_ | 1804122765528137728 |
---|---|
adam_text | THE FEMININE PRINCIPLE
IN THE SIKH VISION
OF THE TRANSCENDENT
NIKKY-GUNINDER KAUR SINGH
Deportment of Religious Studies, Colby College
CAMBRIDGE
UNIVERSITY PRESS
Contents
Preface page xi
Introduction i
1 The Primal Paradox: seeing the Transcendent 16
2 Mother: the Infinite Matrix 48
3 The bride seeks her Groom: an epiphany of inter-
connections 90
4 Durga recalled: transition from mythos to ethos 118
5 The maiden weaves: garlands of songs and waves 150
6 The woman asks: What is life? 170
7 Sundari: the paradigm of Sikh ethics 188
8 Rani Raj Kaur: the mystical journey 205
Conclusion 242
Epilogue • 252
Notes 258
Bibliography 288
Index 298
IX
|
any_adam_object | 1 |
author | Singh, Nikky-Guninder K. |
author_facet | Singh, Nikky-Guninder K. |
author_role | aut |
author_sort | Singh, Nikky-Guninder K. |
author_variant | n g k s ngk ngks |
building | Verbundindex |
bvnumber | BV008397954 |
callnumber-first | B - Philosophy, Psychology, Religion |
callnumber-label | BL2018 |
callnumber-raw | BL2018.5.W65 |
callnumber-search | BL2018.5.W65 |
callnumber-sort | BL 42018.5 W65 |
callnumber-subject | BL - Religions, Mythology, Rationalism |
ctrlnum | (OCoLC)26303491 (DE-599)BVBBV008397954 |
dewey-full | 294.6/2/082 |
dewey-hundreds | 200 - Religion |
dewey-ones | 294 - Religions of Indic origin |
dewey-raw | 294.6/2/082 |
dewey-search | 294.6/2/082 |
dewey-sort | 3294.6 12 282 |
dewey-tens | 290 - Other religions |
discipline | Theologie / Religionswissenschaften |
edition | 1. publ. |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01762nam a2200481 cb4500</leader><controlfield tag="001">BV008397954</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">00000000000000.0</controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">931203s1993 |||| 00||| engod</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0521432871</subfield><subfield code="9">0-521-43287-1</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)26303491</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV008397954</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakddb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield><subfield code="a">DE-473</subfield><subfield code="a">DE-19</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">BL2018.5.W65</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">294.6/2/082</subfield><subfield code="2">20</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Singh, Nikky-Guninder K.</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The feminine principle in the Sikh vision of the transcendent</subfield><subfield code="c">Nikky-Guninder Kaur Singh</subfield></datafield><datafield tag="250" ind1=" " ind2=" "><subfield code="a">1. publ.</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Cambridge u.a.</subfield><subfield code="b">Cambridge Univ. Press</subfield><subfield code="c">1993</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XII, 318 S.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Cambridge studies in religious traditions</subfield><subfield code="v">3</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Sikhs</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Transcendentie</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Vrouwelijkheid</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Religion</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Femininity (Philosophy)</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Feminism</subfield><subfield code="x">Religious aspects</subfield><subfield code="x">Sikhism</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Sikhism</subfield><subfield code="x">Doctrines</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Women in Sikhism</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Frau</subfield><subfield code="0">(DE-588)4018202-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Sikhismus</subfield><subfield code="0">(DE-588)4181283-9</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Sikhismus</subfield><subfield code="0">(DE-588)4181283-9</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Frau</subfield><subfield code="0">(DE-588)4018202-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Cambridge studies in religious traditions</subfield><subfield code="v">3</subfield><subfield code="w">(DE-604)BV004738726</subfield><subfield code="9">3</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HEBIS Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005532374&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-005532374</subfield></datafield></record></collection> |
id | DE-604.BV008397954 |
illustrated | Not Illustrated |
indexdate | 2024-07-09T17:19:05Z |
institution | BVB |
isbn | 0521432871 |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-005532374 |
oclc_num | 26303491 |
open_access_boolean | |
owner | DE-12 DE-473 DE-BY-UBG DE-19 DE-BY-UBM |
owner_facet | DE-12 DE-473 DE-BY-UBG DE-19 DE-BY-UBM |
physical | XII, 318 S. |
publishDate | 1993 |
publishDateSearch | 1993 |
publishDateSort | 1993 |
publisher | Cambridge Univ. Press |
record_format | marc |
series | Cambridge studies in religious traditions |
series2 | Cambridge studies in religious traditions |
spelling | Singh, Nikky-Guninder K. Verfasser aut The feminine principle in the Sikh vision of the transcendent Nikky-Guninder Kaur Singh 1. publ. Cambridge u.a. Cambridge Univ. Press 1993 XII, 318 S. txt rdacontent n rdamedia nc rdacarrier Cambridge studies in religious traditions 3 Sikhs gtt Transcendentie gtt Vrouwelijkheid gtt Religion Femininity (Philosophy) Feminism Religious aspects Sikhism Sikhism Doctrines Women in Sikhism Frau (DE-588)4018202-2 gnd rswk-swf Sikhismus (DE-588)4181283-9 gnd rswk-swf Sikhismus (DE-588)4181283-9 s Frau (DE-588)4018202-2 s DE-604 Cambridge studies in religious traditions 3 (DE-604)BV004738726 3 HEBIS Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005532374&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
spellingShingle | Singh, Nikky-Guninder K. The feminine principle in the Sikh vision of the transcendent Cambridge studies in religious traditions Sikhs gtt Transcendentie gtt Vrouwelijkheid gtt Religion Femininity (Philosophy) Feminism Religious aspects Sikhism Sikhism Doctrines Women in Sikhism Frau (DE-588)4018202-2 gnd Sikhismus (DE-588)4181283-9 gnd |
subject_GND | (DE-588)4018202-2 (DE-588)4181283-9 |
title | The feminine principle in the Sikh vision of the transcendent |
title_auth | The feminine principle in the Sikh vision of the transcendent |
title_exact_search | The feminine principle in the Sikh vision of the transcendent |
title_full | The feminine principle in the Sikh vision of the transcendent Nikky-Guninder Kaur Singh |
title_fullStr | The feminine principle in the Sikh vision of the transcendent Nikky-Guninder Kaur Singh |
title_full_unstemmed | The feminine principle in the Sikh vision of the transcendent Nikky-Guninder Kaur Singh |
title_short | The feminine principle in the Sikh vision of the transcendent |
title_sort | the feminine principle in the sikh vision of the transcendent |
topic | Sikhs gtt Transcendentie gtt Vrouwelijkheid gtt Religion Femininity (Philosophy) Feminism Religious aspects Sikhism Sikhism Doctrines Women in Sikhism Frau (DE-588)4018202-2 gnd Sikhismus (DE-588)4181283-9 gnd |
topic_facet | Sikhs Transcendentie Vrouwelijkheid Religion Femininity (Philosophy) Feminism Religious aspects Sikhism Sikhism Doctrines Women in Sikhism Frau Sikhismus |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005532374&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
volume_link | (DE-604)BV004738726 |
work_keys_str_mv | AT singhnikkyguninderk thefeminineprincipleinthesikhvisionofthetranscendent |