The changing market in financial services: proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis
Gespeichert in:
| Format: | Tagungsbericht Buch |
|---|---|
| Sprache: | English |
| Veröffentlicht: |
Boston u.a.
Kluwer Acad. Publ.
1992
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Beschreibung: | Literaturangaben |
| Beschreibung: | XII, 245 S. graph. Darst. |
| ISBN: | 0792391853 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV008233335 | ||
| 003 | DE-604 | ||
| 005 | 20220708 | ||
| 007 | t | ||
| 008 | 930819s1992 d||| |||| 10||| eng d | ||
| 020 | |a 0792391853 |9 0-7923-9185-3 | ||
| 035 | |a (OCoLC)24793183 | ||
| 035 | |a (DE-599)BVBBV008233335 | ||
| 040 | |a DE-604 |b ger |e rakddb | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-188 | ||
| 050 | 0 | |a HG181 | |
| 082 | 0 | |a 332.1/0973 |2 20 | |
| 084 | |a QK 300 |0 (DE-625)141640: |2 rvk | ||
| 245 | 1 | 0 | |a The changing market in financial services |b proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis |c ed. by R. Alton Gilbert |
| 264 | 1 | |a Boston u.a. |b Kluwer Acad. Publ. |c 1992 | |
| 300 | |a XII, 245 S. |b graph. Darst. | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 500 | |a Literaturangaben | ||
| 650 | 7 | |a Financiële instellingen |2 gtt | |
| 650 | 7 | |a Institutions financières - États-Unis - Congrès |2 ram | |
| 650 | 7 | |a Services financiers - États-Unis - Congrès |2 ram | |
| 650 | 4 | |a Financial services industry |z United States |v Congresses | |
| 650 | 0 | 7 | |a Kreditwesen |0 (DE-588)4032950-1 |2 gnd |9 rswk-swf |
| 651 | 4 | |a USA | |
| 651 | 7 | |a USA |0 (DE-588)4078704-7 |2 gnd |9 rswk-swf | |
| 655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |y 1990 |z Saint Louis, Mo. |2 gnd-content | |
| 689 | 0 | 0 | |a USA |0 (DE-588)4078704-7 |D g |
| 689 | 0 | 1 | |a Kreditwesen |0 (DE-588)4032950-1 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Gilbert, R. A. |e Sonstige |4 oth | |
| 710 | 2 | |a Federal Reserve Bank of St. Louis |e Sonstige |0 (DE-588)75261-7 |4 oth | |
| 711 | 2 | |a Economic Policy Conference |n 15 |d 1990 |c Saint Louis, Mo. |j Sonstige |0 (DE-588)5080327-X |4 oth | |
| 856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005434566&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-005434566 | ||
Datensatz im Suchindex
| _version_ | 1804122620412559360 |
|---|---|
| adam_text | Contents
Contributing Authors vii
Preface ix
I 1
1
The Opening of New Markets for Bank Assets 3
Gary Gorton and George G. Pennacchi
Commentary by Stuart I. Greenbaum 35
II 39
2
Interstate Banking, Bank Expansion and Valuation 41
Gerald A. Hanweck
Commentary by Peter S. Rose 93
3
The Market for Home Mortgage Credit: Recent Changes and Future
Prospects 99
Patric H. Hendershott
Commentary by Herbert M. Kaufman 125
4
Equity Underwriting Risk 129
J. Nellie Liang and James M. O Brien
v
vi THE CHANGING MARKET IN FINANCIAL SERVICES
III 159
5
The Competitive Impact of Foreign Commercial Banks in the United
States 161
Lawrence G. Goldberg
Commentary by Gary C. Zimmerman 201
6
The Competitive Impact of Foreign Underwriters in the United States 211
Robert Nachtmann and Frederick J. Phillips Patrick
Commentary by Samuel L. Hayes 241
Index 247
|
| any_adam_object | 1 |
| building | Verbundindex |
| bvnumber | BV008233335 |
| callnumber-first | H - Social Science |
| callnumber-label | HG181 |
| callnumber-raw | HG181 |
| callnumber-search | HG181 |
| callnumber-sort | HG 3181 |
| callnumber-subject | HG - Finance |
| classification_rvk | QK 300 |
| ctrlnum | (OCoLC)24793183 (DE-599)BVBBV008233335 |
| dewey-full | 332.1/0973 |
| dewey-hundreds | 300 - Social sciences |
| dewey-ones | 332 - Financial economics |
| dewey-raw | 332.1/0973 |
| dewey-search | 332.1/0973 |
| dewey-sort | 3332.1 3973 |
| dewey-tens | 330 - Economics |
| discipline | Wirtschaftswissenschaften |
| format | Conference Proceeding Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01995nam a2200469 c 4500</leader><controlfield tag="001">BV008233335</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20220708 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">930819s1992 d||| |||| 10||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0792391853</subfield><subfield code="9">0-7923-9185-3</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)24793183</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV008233335</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakddb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-188</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">HG181</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">332.1/0973</subfield><subfield code="2">20</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">QK 300</subfield><subfield code="0">(DE-625)141640:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The changing market in financial services</subfield><subfield code="b">proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis</subfield><subfield code="c">ed. by R. Alton Gilbert</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Boston u.a.</subfield><subfield code="b">Kluwer Acad. Publ.</subfield><subfield code="c">1992</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XII, 245 S.</subfield><subfield code="b">graph. Darst.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="500" ind1=" " ind2=" "><subfield code="a">Literaturangaben</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Financiële instellingen</subfield><subfield code="2">gtt</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Institutions financières - États-Unis - Congrès</subfield><subfield code="2">ram</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Services financiers - États-Unis - Congrès</subfield><subfield code="2">ram</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Financial services industry</subfield><subfield code="z">United States</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kreditwesen</subfield><subfield code="0">(DE-588)4032950-1</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="4"><subfield code="a">USA</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">USA</subfield><subfield code="0">(DE-588)4078704-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="y">1990</subfield><subfield code="z">Saint Louis, Mo.</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">USA</subfield><subfield code="0">(DE-588)4078704-7</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Kreditwesen</subfield><subfield code="0">(DE-588)4032950-1</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Gilbert, R. A.</subfield><subfield code="e">Sonstige</subfield><subfield code="4">oth</subfield></datafield><datafield tag="710" ind1="2" ind2=" "><subfield code="a">Federal Reserve Bank of St. Louis</subfield><subfield code="e">Sonstige</subfield><subfield code="0">(DE-588)75261-7</subfield><subfield code="4">oth</subfield></datafield><datafield tag="711" ind1="2" ind2=" "><subfield code="a">Economic Policy Conference</subfield><subfield code="n">15</subfield><subfield code="d">1990</subfield><subfield code="c">Saint Louis, Mo.</subfield><subfield code="j">Sonstige</subfield><subfield code="0">(DE-588)5080327-X</subfield><subfield code="4">oth</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005434566&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-005434566</subfield></datafield></record></collection> |
| genre | (DE-588)1071861417 Konferenzschrift 1990 Saint Louis, Mo. gnd-content |
| genre_facet | Konferenzschrift 1990 Saint Louis, Mo. |
| geographic | USA USA (DE-588)4078704-7 gnd |
| geographic_facet | USA |
| id | DE-604.BV008233335 |
| illustrated | Illustrated |
| indexdate | 2024-07-09T17:16:46Z |
| institution | BVB |
| institution_GND | (DE-588)75261-7 (DE-588)5080327-X |
| isbn | 0792391853 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-005434566 |
| oclc_num | 24793183 |
| open_access_boolean | |
| owner | DE-188 |
| owner_facet | DE-188 |
| physical | XII, 245 S. graph. Darst. |
| publishDate | 1992 |
| publishDateSearch | 1992 |
| publishDateSort | 1992 |
| publisher | Kluwer Acad. Publ. |
| record_format | marc |
| spelling | The changing market in financial services proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis ed. by R. Alton Gilbert Boston u.a. Kluwer Acad. Publ. 1992 XII, 245 S. graph. Darst. txt rdacontent n rdamedia nc rdacarrier Literaturangaben Financiële instellingen gtt Institutions financières - États-Unis - Congrès ram Services financiers - États-Unis - Congrès ram Financial services industry United States Congresses Kreditwesen (DE-588)4032950-1 gnd rswk-swf USA USA (DE-588)4078704-7 gnd rswk-swf (DE-588)1071861417 Konferenzschrift 1990 Saint Louis, Mo. gnd-content USA (DE-588)4078704-7 g Kreditwesen (DE-588)4032950-1 s DE-604 Gilbert, R. A. Sonstige oth Federal Reserve Bank of St. Louis Sonstige (DE-588)75261-7 oth Economic Policy Conference 15 1990 Saint Louis, Mo. Sonstige (DE-588)5080327-X oth HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005434566&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | The changing market in financial services proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis Financiële instellingen gtt Institutions financières - États-Unis - Congrès ram Services financiers - États-Unis - Congrès ram Financial services industry United States Congresses Kreditwesen (DE-588)4032950-1 gnd |
| subject_GND | (DE-588)4032950-1 (DE-588)4078704-7 (DE-588)1071861417 |
| title | The changing market in financial services proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis |
| title_auth | The changing market in financial services proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis |
| title_exact_search | The changing market in financial services proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis |
| title_full | The changing market in financial services proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis ed. by R. Alton Gilbert |
| title_fullStr | The changing market in financial services proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis ed. by R. Alton Gilbert |
| title_full_unstemmed | The changing market in financial services proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis ed. by R. Alton Gilbert |
| title_short | The changing market in financial services |
| title_sort | the changing market in financial services proceedings of the fifteenth annual economic policy conference of the federal reserve bank of st louis |
| title_sub | proceedings of the fifteenth Annual Economic Policy Conference of the Federal Reserve Bank of St. Louis |
| topic | Financiële instellingen gtt Institutions financières - États-Unis - Congrès ram Services financiers - États-Unis - Congrès ram Financial services industry United States Congresses Kreditwesen (DE-588)4032950-1 gnd |
| topic_facet | Financiële instellingen Institutions financières - États-Unis - Congrès Services financiers - États-Unis - Congrès Financial services industry United States Congresses Kreditwesen USA Konferenzschrift 1990 Saint Louis, Mo. |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005434566&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT gilbertra thechangingmarketinfinancialservicesproceedingsofthefifteenthannualeconomicpolicyconferenceofthefederalreservebankofstlouis AT federalreservebankofstlouis thechangingmarketinfinancialservicesproceedingsofthefifteenthannualeconomicpolicyconferenceofthefederalreservebankofstlouis AT economicpolicyconferencesaintlouismo thechangingmarketinfinancialservicesproceedingsofthefifteenthannualeconomicpolicyconferenceofthefederalreservebankofstlouis |