Comprehensive systems design: a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990]
Saved in:
Format: | Conference Proceeding Book |
---|---|
Language: | English |
Published: |
Berlin [u.a.]
Springer
1993
|
Series: | NATO: [NATO ASI series / F]
95 |
Subjects: | |
Online Access: | Inhaltsverzeichnis |
Physical Description: | IX, 436 S. graph. Darst. |
ISBN: | 3540566775 0387566775 |
Staff View
MARC
LEADER | 00000nam a2200000 cb4500 | ||
---|---|---|---|
001 | BV008100239 | ||
003 | DE-604 | ||
005 | 20250312 | ||
007 | t| | ||
008 | 930712s1993 gw d||| |||| 10||| eng d | ||
020 | |a 3540566775 |9 3-540-56677-5 | ||
020 | |a 0387566775 |9 0-387-56677-5 | ||
035 | |a (OCoLC)246754120 | ||
035 | |a (DE-599)BVBBV008100239 | ||
040 | |a DE-604 |b ger |e rakddb | ||
041 | 0 | |a eng | |
044 | |a gw |c DE | ||
049 | |a DE-473 |a DE-19 |a DE-12 |a DE-83 |a DE-11 |a DE-188 | ||
050 | 0 | |a LB1028.38 | |
082 | 0 | |a 371.3028 | |
084 | |a SD 1990 |0 (DE-625)142724: |2 rvk | ||
084 | |a ST 670 |0 (DE-625)143689: |2 rvk | ||
245 | 1 | 0 | |a Comprehensive systems design |b a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990] |c ed. by Charles M. Reigeluth ... |
264 | 1 | |a Berlin [u.a.] |b Springer |c 1993 | |
300 | |a IX, 436 S. |b graph. Darst. | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
490 | 1 | |a NATO: [NATO ASI series / F] |v 95 | |
650 | 4 | |a Educational innovations |v Congresses | |
650 | 4 | |a Educational technology |v Congresses | |
650 | 4 | |a Instructional systems |x Design |v Congresses | |
650 | 0 | 7 | |a Systementwicklung |0 (DE-588)4126945-7 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Bildungssystem |0 (DE-588)4069467-7 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Pädagogik |0 (DE-588)4044302-4 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Systementwurf |0 (DE-588)4261480-6 |2 gnd |9 rswk-swf |
655 | 7 | |0 (DE-588)1071861417 |a Konferenzschrift |y 1990 |z Pacific Grove Calif. |2 gnd-content | |
689 | 0 | 0 | |a Systementwurf |0 (DE-588)4261480-6 |D s |
689 | 0 | 1 | |a Bildungssystem |0 (DE-588)4069467-7 |D s |
689 | 0 | |5 DE-604 | |
689 | 1 | 0 | |a Systementwicklung |0 (DE-588)4126945-7 |D s |
689 | 1 | 1 | |a Pädagogik |0 (DE-588)4044302-4 |D s |
689 | 1 | |5 DE-604 | |
700 | 1 | |a Reigeluth, Charles M. |d 1946- |e Sonstige |0 (DE-588)1220801143 |4 oth | |
711 | 2 | |a Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology |d 1990 |c Pacific Grove, Calif. |j Sonstige |0 (DE-588)2130723-4 |4 oth | |
810 | 2 | |a F] |t NATO: [NATO ASI series |v 95 |w (DE-604)BV000013052 |9 95 | |
856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005336254&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
943 | 1 | |a oai:aleph.bib-bvb.de:BVB01-005336254 |
Record in the Search Index
_version_ | 1826393485229424640 |
---|---|
adam_text |
Table of Contents
Editors' Introduction 1
Part 1 The Framing Papers
Systems Design: A Creative Response to the Current Educational Predicament . 9
Bela H.Banathy
Principles of Educational Systems Design 50
Charles M. Reigeluth
Structuring the Program of the NATO Advanced Research Workshop:
An Architecture of Decision-Oriented Disciplined Enquiry 67
Bela H.Banathy
Part 2 Thematic Contributions
1 The Conceptual and Empirical Contexts of Comprehensive
Systems Design
Education as a Process of Increasing Access to Societal Resources:
Design and Methodology 85
Gerard de Zeeuw
Human Learning and Its Relation to Evolution and Needs Satisfaction:
Implications for the Design of Educational Systems 95
Nicolas C. Paritsis
The Empirical Grounding of System Performance Measurements 104
Bela Antal Banathy
The Designing Community: A Learning Community 109
Georges Goulet, Andri Dolbec
Definition of Education and Meta-Design of Educational Systems 121
Nagib Callaos, Belkis de Callaos
Assessing the Adequacy of a Social System Design 134
C. Lynn Jenks, Mary Arnsler
2 The Systems Design Focus
Design Inquiry as an Intellectual Technology for the Design of
Educational Systems 145
Harold G. Nelson
The Evolution of a Design Approach: A Historical Perspective and Its
Relevance to the Design of Educational Systems 154
Wojciech Gasparski
Surrendering to the Environment in Educational System Design 165
Oguz N. Baburoglu
'Jumping Out' of the Existing System During Design Genesis:
Penetrating the Anxiety Barrier 174
Tad Gougen Frantz
Designing Value-Based Educational Systems 191
Thorbjorn Meyer, Peter Pruzan
Retrospective Design Analysis: A New Educational Technology 206
Ian Macnaughton
3 A Systems View of Designing Educational Systems
The Application of Systems Thinking to the Design of Educational Systems . 225
Rafael Rodriguez Delgado
A Systems-Approach Knowledge Base for Education 238
Hilda J.Blanco
Approaches and Methods of Systems Design: Critical Pedagogy 253
Wendy Gregory
A Systems View of Restructuring Education 260
Theodore W. Frick
Openness in a General Process Model for Systems Design in Education 272
Arne Collen, Giafranco Minati
4 The Educational Context of Systems Design
School Reform Movements: Tinkering with the System .281
Dwight W. Allen
Characteristics of Educational Systems and Their Development:
A Contribution to Understanding Differences in System^ in Europe
and the United States 302
Theo MM. Liket
Applying Systems Theory Through the Lens of Learning:
What Does Learning Research Say? 314
Beau Fly Jones, Randy A. Knuth, Steve Baxendale
The Next Step in Educational Systems Design:
Some Contributions From Learning Systems Design 334
IanMcArthur
Learning Systems: Is There a Need for Change? 350
NimalJayaratna
Systems Design Guidelines for Change 354
NimalJayaratna
A Conceptual Framework for Systems Design of Education 357
P. David Mitchell
5 High Technology Focus in Systems Design
Hypersystems: A Base for Specification of Computer-Supported
Self-Learning Social Systems 381
Kristo Ivanov
New Educational Technologies Cannot be Fully Integrated in
Existing Educational Systems 408
Monique Grandbastien
Educational Technology Planning: Scanning the North American K-12
Education Environment 421
Wayne G. Blair
Index of Authors 437 |
any_adam_object | 1 |
author_GND | (DE-588)1220801143 |
building | Verbundindex |
bvnumber | BV008100239 |
callnumber-first | L - Education |
callnumber-label | LB1028 |
callnumber-raw | LB1028.38 |
callnumber-search | LB1028.38 |
callnumber-sort | LB 41028.38 |
callnumber-subject | LB - Theory and Practice of Education |
classification_rvk | SD 1990 ST 670 |
ctrlnum | (OCoLC)246754120 (DE-599)BVBBV008100239 |
dewey-full | 371.3028 |
dewey-hundreds | 300 - Social sciences |
dewey-ones | 371 - Schools and their activities; special education |
dewey-raw | 371.3028 |
dewey-search | 371.3028 |
dewey-sort | 3371.3028 |
dewey-tens | 370 - Education |
discipline | Pädagogik Informatik Mathematik |
format | Conference Proceeding Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>00000nam a2200000 cb4500</leader><controlfield tag="001">BV008100239</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20250312</controlfield><controlfield tag="007">t|</controlfield><controlfield tag="008">930712s1993 gw d||| |||| 10||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3540566775</subfield><subfield code="9">3-540-56677-5</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0387566775</subfield><subfield code="9">0-387-56677-5</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)246754120</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV008100239</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakddb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="044" ind1=" " ind2=" "><subfield code="a">gw</subfield><subfield code="c">DE</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-473</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-12</subfield><subfield code="a">DE-83</subfield><subfield code="a">DE-11</subfield><subfield code="a">DE-188</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">LB1028.38</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">371.3028</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">SD 1990</subfield><subfield code="0">(DE-625)142724:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">ST 670</subfield><subfield code="0">(DE-625)143689:</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Comprehensive systems design</subfield><subfield code="b">a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990]</subfield><subfield code="c">ed. by Charles M. Reigeluth ...</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Berlin [u.a.]</subfield><subfield code="b">Springer</subfield><subfield code="c">1993</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">IX, 436 S.</subfield><subfield code="b">graph. Darst.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">NATO: [NATO ASI series / F]</subfield><subfield code="v">95</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Educational innovations</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Educational technology</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Instructional systems</subfield><subfield code="x">Design</subfield><subfield code="v">Congresses</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Systementwicklung</subfield><subfield code="0">(DE-588)4126945-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Bildungssystem</subfield><subfield code="0">(DE-588)4069467-7</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Pädagogik</subfield><subfield code="0">(DE-588)4044302-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Systementwurf</subfield><subfield code="0">(DE-588)4261480-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)1071861417</subfield><subfield code="a">Konferenzschrift</subfield><subfield code="y">1990</subfield><subfield code="z">Pacific Grove Calif.</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Systementwurf</subfield><subfield code="0">(DE-588)4261480-6</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Bildungssystem</subfield><subfield code="0">(DE-588)4069467-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Systementwicklung</subfield><subfield code="0">(DE-588)4126945-7</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="1"><subfield code="a">Pädagogik</subfield><subfield code="0">(DE-588)4044302-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Reigeluth, Charles M.</subfield><subfield code="d">1946-</subfield><subfield code="e">Sonstige</subfield><subfield code="0">(DE-588)1220801143</subfield><subfield code="4">oth</subfield></datafield><datafield tag="711" ind1="2" ind2=" "><subfield code="a">Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology</subfield><subfield code="d">1990</subfield><subfield code="c">Pacific Grove, Calif.</subfield><subfield code="j">Sonstige</subfield><subfield code="0">(DE-588)2130723-4</subfield><subfield code="4">oth</subfield></datafield><datafield tag="810" ind1="2" ind2=" "><subfield code="a">F]</subfield><subfield code="t">NATO: [NATO ASI series</subfield><subfield code="v">95</subfield><subfield code="w">(DE-604)BV000013052</subfield><subfield code="9">95</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005336254&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="943" ind1="1" ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-005336254</subfield></datafield></record></collection> |
genre | (DE-588)1071861417 Konferenzschrift 1990 Pacific Grove Calif. gnd-content |
genre_facet | Konferenzschrift 1990 Pacific Grove Calif. |
id | DE-604.BV008100239 |
illustrated | Illustrated |
indexdate | 2025-03-12T13:02:38Z |
institution | BVB |
institution_GND | (DE-588)2130723-4 |
isbn | 3540566775 0387566775 |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-005336254 |
oclc_num | 246754120 |
open_access_boolean | |
owner | DE-473 DE-BY-UBG DE-19 DE-BY-UBM DE-12 DE-83 DE-11 DE-188 |
owner_facet | DE-473 DE-BY-UBG DE-19 DE-BY-UBM DE-12 DE-83 DE-11 DE-188 |
physical | IX, 436 S. graph. Darst. |
publishDate | 1993 |
publishDateSearch | 1993 |
publishDateSort | 1993 |
publisher | Springer |
record_format | marc |
series2 | NATO: [NATO ASI series / F] |
spelling | Comprehensive systems design a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990] ed. by Charles M. Reigeluth ... Berlin [u.a.] Springer 1993 IX, 436 S. graph. Darst. txt rdacontent n rdamedia nc rdacarrier NATO: [NATO ASI series / F] 95 Educational innovations Congresses Educational technology Congresses Instructional systems Design Congresses Systementwicklung (DE-588)4126945-7 gnd rswk-swf Bildungssystem (DE-588)4069467-7 gnd rswk-swf Pädagogik (DE-588)4044302-4 gnd rswk-swf Systementwurf (DE-588)4261480-6 gnd rswk-swf (DE-588)1071861417 Konferenzschrift 1990 Pacific Grove Calif. gnd-content Systementwurf (DE-588)4261480-6 s Bildungssystem (DE-588)4069467-7 s DE-604 Systementwicklung (DE-588)4126945-7 s Pädagogik (DE-588)4044302-4 s Reigeluth, Charles M. 1946- Sonstige (DE-588)1220801143 oth Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology 1990 Pacific Grove, Calif. Sonstige (DE-588)2130723-4 oth F] NATO: [NATO ASI series 95 (DE-604)BV000013052 95 HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005336254&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
spellingShingle | Comprehensive systems design a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990] Educational innovations Congresses Educational technology Congresses Instructional systems Design Congresses Systementwicklung (DE-588)4126945-7 gnd Bildungssystem (DE-588)4069467-7 gnd Pädagogik (DE-588)4044302-4 gnd Systementwurf (DE-588)4261480-6 gnd |
subject_GND | (DE-588)4126945-7 (DE-588)4069467-7 (DE-588)4044302-4 (DE-588)4261480-6 (DE-588)1071861417 |
title | Comprehensive systems design a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990] |
title_auth | Comprehensive systems design a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990] |
title_exact_search | Comprehensive systems design a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990] |
title_full | Comprehensive systems design a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990] ed. by Charles M. Reigeluth ... |
title_fullStr | Comprehensive systems design a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990] ed. by Charles M. Reigeluth ... |
title_full_unstemmed | Comprehensive systems design a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990] ed. by Charles M. Reigeluth ... |
title_short | Comprehensive systems design |
title_sort | comprehensive systems design a new educational technology proceedings of the nato advanced research workshop on comprehensive systems design a new educational technology held in pacific grove california december 2 7 1990 |
title_sub | a new educational technology ; [proceedings of the NATO Advanced Research Workshop on Comprehensive Systems Design, a New Educational Technology, held in Pacific Grove, California, December 2 - 7, 1990] |
topic | Educational innovations Congresses Educational technology Congresses Instructional systems Design Congresses Systementwicklung (DE-588)4126945-7 gnd Bildungssystem (DE-588)4069467-7 gnd Pädagogik (DE-588)4044302-4 gnd Systementwurf (DE-588)4261480-6 gnd |
topic_facet | Educational innovations Congresses Educational technology Congresses Instructional systems Design Congresses Systementwicklung Bildungssystem Pädagogik Systementwurf Konferenzschrift 1990 Pacific Grove Calif. |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=005336254&sequence=000002&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
volume_link | (DE-604)BV000013052 |
work_keys_str_mv | AT reigeluthcharlesm comprehensivesystemsdesignaneweducationaltechnologyproceedingsofthenatoadvancedresearchworkshoponcomprehensivesystemsdesignaneweducationaltechnologyheldinpacificgrovecaliforniadecember271990 AT advancedresearchworkshoponcomprehensivesystemsdesignaneweducationaltechnologypacificgrovecalif comprehensivesystemsdesignaneweducationaltechnologyproceedingsofthenatoadvancedresearchworkshoponcomprehensivesystemsdesignaneweducationaltechnologyheldinpacificgrovecaliforniadecember271990 |