Ariel like a harpy: Shelley, Mary and Frankenstein
Saved in:
Main Author: | |
---|---|
Format: | Book |
Language: | English |
Published: |
London
Gollancz
1972
|
Subjects: | |
Online Access: | Inhaltsverzeichnis |
Physical Description: | 352 S. |
ISBN: | 0575013931 |
Staff View
MARC
LEADER | 00000nam a2200000 c 4500 | ||
---|---|---|---|
001 | BV003039032 | ||
003 | DE-604 | ||
005 | 20131127 | ||
007 | t | ||
008 | 900725s1972 |||| 00||| eng d | ||
020 | |a 0575013931 |9 0-575-01393-1 | ||
035 | |a (OCoLC)403290 | ||
035 | |a (DE-599)BVBBV003039032 | ||
040 | |a DE-604 |b ger |e rakddb | ||
041 | 0 | |a eng | |
049 | |a DE-12 |a DE-384 |a DE-739 |a DE-824 |a DE-20 |a DE-19 |a DE-29 |a DE-83 |a DE-188 | ||
050 | 0 | |a PR5397 | |
082 | 0 | |a 823/.7 | |
084 | |a HL 4345 |0 (DE-625)50702:11852 |2 rvk | ||
084 | |a HL 4385 |0 (DE-625)50703:11852 |2 rvk | ||
100 | 1 | |a Small, Christopher |e Verfasser |4 aut | |
245 | 1 | 0 | |a Ariel like a harpy |b Shelley, Mary and Frankenstein |c by Christopher Small |
264 | 1 | |a London |b Gollancz |c 1972 | |
300 | |a 352 S. | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
600 | 1 | 4 | |a Shelley, Mary Wollstonecraft <1797-1851> |t Frankenstein |
600 | 1 | 4 | |a Shelley, Percy Bysshe <1792-1822> |x Marriage |
600 | 1 | 7 | |a Shelley, Mary |d 1797-1851 |t Frankenstein |0 (DE-588)4220200-0 |2 gnd |9 rswk-swf |
600 | 0 | 7 | |a Ariel |c Literarische Gestalt |0 (DE-588)120248638 |2 gnd |9 rswk-swf |
648 | 4 | |a Geschichte 1800-1900 | |
650 | 4 | |a Geschichte | |
650 | 4 | |a Frankenstein's monster (Fictitious character) | |
650 | 4 | |a Frankenstein, Victor (Fictitious character) | |
650 | 4 | |a Horror tales, English |x History and criticism | |
650 | 4 | |a Monsters in literature | |
650 | 4 | |a Scientists in literature | |
650 | 4 | |a Women and literature |z England |x History |y 19th century | |
689 | 0 | 0 | |a Shelley, Mary |d 1797-1851 |t Frankenstein |0 (DE-588)4220200-0 |D u |
689 | 0 | 1 | |a Ariel |c Literarische Gestalt |0 (DE-588)120248638 |D p |
689 | 0 | |5 DE-604 | |
856 | 4 | 2 | |m HBZ Datenaustausch |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=001903329&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
940 | 1 | |q TUB-nveb | |
999 | |a oai:aleph.bib-bvb.de:BVB01-001903329 | ||
980 | 4 | |a (DE-12)AK20630396 |
Record in the Search Index
_version_ | 1804117327246000128 |
---|---|
adam_text | Titel: Ariel like a Harpy
Autor: Small, Christopher
Jahr: 1972
1
2
3
4
5
6
7
8
9
10
11
12
13
14
13
30
48
68
100
122
156
171
196
218
241
270
292
311
332
344
347
CONTENTS
Introductory: Metaphor and Myth
Birth of the Story
The Modern Prometheus
Godwin and Godwinism
Shelley and Frankenstein
Ariel and Caliban
The Pursuing Shadow
Innocence and Guilt
Prophecy and Projection
Prometheus Unbound
Science and Poetry
The Redeeming Imagination
Robots and Resurrection
The Deep Truth: Conclusion
Notes
Bibliography
Index
|
any_adam_object | 1 |
author | Small, Christopher |
author_facet | Small, Christopher |
author_role | aut |
author_sort | Small, Christopher |
author_variant | c s cs |
building | Verbundindex |
bvnumber | BV003039032 |
callnumber-first | P - Language and Literature |
callnumber-label | PR5397 |
callnumber-raw | PR5397 |
callnumber-search | PR5397 |
callnumber-sort | PR 45397 |
callnumber-subject | PR - English Literature |
classification_rvk | HL 4345 HL 4385 |
ctrlnum | (OCoLC)403290 (DE-599)BVBBV003039032 |
dewey-full | 823/.7 |
dewey-hundreds | 800 - Literature (Belles-lettres) and rhetoric |
dewey-ones | 823 - English fiction |
dewey-raw | 823/.7 |
dewey-search | 823/.7 |
dewey-sort | 3823 17 |
dewey-tens | 820 - English & Old English literatures |
discipline | Anglistik / Amerikanistik |
era | Geschichte 1800-1900 |
era_facet | Geschichte 1800-1900 |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02070nam a2200517 c 4500</leader><controlfield tag="001">BV003039032</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20131127 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">900725s1972 |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0575013931</subfield><subfield code="9">0-575-01393-1</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)403290</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV003039032</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakddb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield><subfield code="a">DE-384</subfield><subfield code="a">DE-739</subfield><subfield code="a">DE-824</subfield><subfield code="a">DE-20</subfield><subfield code="a">DE-19</subfield><subfield code="a">DE-29</subfield><subfield code="a">DE-83</subfield><subfield code="a">DE-188</subfield></datafield><datafield tag="050" ind1=" " ind2="0"><subfield code="a">PR5397</subfield></datafield><datafield tag="082" ind1="0" ind2=" "><subfield code="a">823/.7</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">HL 4345</subfield><subfield code="0">(DE-625)50702:11852</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">HL 4385</subfield><subfield code="0">(DE-625)50703:11852</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Small, Christopher</subfield><subfield code="e">Verfasser</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Ariel like a harpy</subfield><subfield code="b">Shelley, Mary and Frankenstein</subfield><subfield code="c">by Christopher Small</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">London</subfield><subfield code="b">Gollancz</subfield><subfield code="c">1972</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">352 S.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="600" ind1="1" ind2="4"><subfield code="a">Shelley, Mary Wollstonecraft <1797-1851></subfield><subfield code="t">Frankenstein</subfield></datafield><datafield tag="600" ind1="1" ind2="4"><subfield code="a">Shelley, Percy Bysshe <1792-1822></subfield><subfield code="x">Marriage</subfield></datafield><datafield tag="600" ind1="1" ind2="7"><subfield code="a">Shelley, Mary</subfield><subfield code="d">1797-1851</subfield><subfield code="t">Frankenstein</subfield><subfield code="0">(DE-588)4220200-0</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="600" ind1="0" ind2="7"><subfield code="a">Ariel</subfield><subfield code="c">Literarische Gestalt</subfield><subfield code="0">(DE-588)120248638</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="648" ind1=" " ind2="4"><subfield code="a">Geschichte 1800-1900</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Geschichte</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Frankenstein's monster (Fictitious character)</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Frankenstein, Victor (Fictitious character)</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Horror tales, English</subfield><subfield code="x">History and criticism</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Monsters in literature</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Scientists in literature</subfield></datafield><datafield tag="650" ind1=" " ind2="4"><subfield code="a">Women and literature</subfield><subfield code="z">England</subfield><subfield code="x">History</subfield><subfield code="y">19th century</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Shelley, Mary</subfield><subfield code="d">1797-1851</subfield><subfield code="t">Frankenstein</subfield><subfield code="0">(DE-588)4220200-0</subfield><subfield code="D">u</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Ariel</subfield><subfield code="c">Literarische Gestalt</subfield><subfield code="0">(DE-588)120248638</subfield><subfield code="D">p</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">HBZ Datenaustausch</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=001903329&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="940" ind1="1" ind2=" "><subfield code="q">TUB-nveb</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-001903329</subfield></datafield><datafield tag="980" ind1="4" ind2=" "><subfield code="a">(DE-12)AK20630396</subfield></datafield></record></collection> |
id | DE-604.BV003039032 |
illustrated | Not Illustrated |
indexdate | 2024-07-09T15:52:38Z |
institution | BVB |
isbn | 0575013931 |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-001903329 |
oclc_num | 403290 |
open_access_boolean | |
owner | DE-12 DE-384 DE-739 DE-824 DE-20 DE-19 DE-BY-UBM DE-29 DE-83 DE-188 |
owner_facet | DE-12 DE-384 DE-739 DE-824 DE-20 DE-19 DE-BY-UBM DE-29 DE-83 DE-188 |
physical | 352 S. |
psigel | TUB-nveb |
publishDate | 1972 |
publishDateSearch | 1972 |
publishDateSort | 1972 |
publisher | Gollancz |
record_format | marc |
spelling | Small, Christopher Verfasser aut Ariel like a harpy Shelley, Mary and Frankenstein by Christopher Small London Gollancz 1972 352 S. txt rdacontent n rdamedia nc rdacarrier Shelley, Mary Wollstonecraft <1797-1851> Frankenstein Shelley, Percy Bysshe <1792-1822> Marriage Shelley, Mary 1797-1851 Frankenstein (DE-588)4220200-0 gnd rswk-swf Ariel Literarische Gestalt (DE-588)120248638 gnd rswk-swf Geschichte 1800-1900 Geschichte Frankenstein's monster (Fictitious character) Frankenstein, Victor (Fictitious character) Horror tales, English History and criticism Monsters in literature Scientists in literature Women and literature England History 19th century Shelley, Mary 1797-1851 Frankenstein (DE-588)4220200-0 u Ariel Literarische Gestalt (DE-588)120248638 p DE-604 HBZ Datenaustausch application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=001903329&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
spellingShingle | Small, Christopher Ariel like a harpy Shelley, Mary and Frankenstein Shelley, Mary Wollstonecraft <1797-1851> Frankenstein Shelley, Percy Bysshe <1792-1822> Marriage Shelley, Mary 1797-1851 Frankenstein (DE-588)4220200-0 gnd Ariel Literarische Gestalt (DE-588)120248638 gnd Geschichte Frankenstein's monster (Fictitious character) Frankenstein, Victor (Fictitious character) Horror tales, English History and criticism Monsters in literature Scientists in literature Women and literature England History 19th century |
subject_GND | (DE-588)4220200-0 (DE-588)120248638 |
title | Ariel like a harpy Shelley, Mary and Frankenstein |
title_auth | Ariel like a harpy Shelley, Mary and Frankenstein |
title_exact_search | Ariel like a harpy Shelley, Mary and Frankenstein |
title_full | Ariel like a harpy Shelley, Mary and Frankenstein by Christopher Small |
title_fullStr | Ariel like a harpy Shelley, Mary and Frankenstein by Christopher Small |
title_full_unstemmed | Ariel like a harpy Shelley, Mary and Frankenstein by Christopher Small |
title_short | Ariel like a harpy |
title_sort | ariel like a harpy shelley mary and frankenstein |
title_sub | Shelley, Mary and Frankenstein |
topic | Shelley, Mary Wollstonecraft <1797-1851> Frankenstein Shelley, Percy Bysshe <1792-1822> Marriage Shelley, Mary 1797-1851 Frankenstein (DE-588)4220200-0 gnd Ariel Literarische Gestalt (DE-588)120248638 gnd Geschichte Frankenstein's monster (Fictitious character) Frankenstein, Victor (Fictitious character) Horror tales, English History and criticism Monsters in literature Scientists in literature Women and literature England History 19th century |
topic_facet | Shelley, Mary Wollstonecraft <1797-1851> Frankenstein Shelley, Percy Bysshe <1792-1822> Marriage Shelley, Mary 1797-1851 Frankenstein Ariel Literarische Gestalt Geschichte Frankenstein's monster (Fictitious character) Frankenstein, Victor (Fictitious character) Horror tales, English History and criticism Monsters in literature Scientists in literature Women and literature England History 19th century |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=001903329&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
work_keys_str_mv | AT smallchristopher ariellikeaharpyshelleymaryandfrankenstein |