The interrupted system: Israeli civilians in war and routine times
Saved in:
Main Author: | |
---|---|
Format: | Book |
Language: | English |
Published: |
New Brunswick (USA) [u.a.]
Transaction Books
1985
|
Subjects: | |
Online Access: | Inhaltsverzeichnis |
Physical Description: | XVIII, 219 S. |
ISBN: | 0887380204 |
Staff View
MARC
LEADER | 00000nam a2200000 c 4500 | ||
---|---|---|---|
001 | BV000364327 | ||
003 | DE-604 | ||
005 | 20200327 | ||
007 | t | ||
008 | 870612s1985 |||| 00||| eng d | ||
020 | |a 0887380204 |9 0-88738-020-4 | ||
035 | |a (OCoLC)230815681 | ||
035 | |a (DE-599)BVBBV000364327 | ||
040 | |a DE-604 |b ger |e rakddb | ||
041 | 0 | |a eng | |
049 | |a DE-12 |a DE-473 |a DE-706 | ||
084 | |a MH 84940 |0 (DE-625)122919:12226 |2 rvk | ||
100 | 1 | |a Kimerling, Barukh |d 1939-2007 |e Verfasser |0 (DE-588)124517234 |4 aut | |
245 | 1 | 0 | |a The interrupted system |b Israeli civilians in war and routine times |
264 | 1 | |a New Brunswick (USA) [u.a.] |b Transaction Books |c 1985 | |
300 | |a XVIII, 219 S. | ||
336 | |b txt |2 rdacontent | ||
337 | |b n |2 rdamedia | ||
338 | |b nc |2 rdacarrier | ||
650 | 0 | 7 | |a Krieg |0 (DE-588)4033114-3 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Kriegssoziologie |0 (DE-588)4760356-2 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Gesellschaft |0 (DE-588)4020588-5 |2 gnd |9 rswk-swf |
650 | 0 | 7 | |a Militärsoziologie |0 (DE-588)4169968-3 |2 gnd |9 rswk-swf |
651 | 7 | |a Israel |0 (DE-588)4027808-6 |2 gnd |9 rswk-swf | |
689 | 0 | 0 | |a Israel |0 (DE-588)4027808-6 |D g |
689 | 0 | 1 | |a Kriegssoziologie |0 (DE-588)4760356-2 |D s |
689 | 0 | |5 DE-604 | |
689 | 1 | 0 | |a Israel |0 (DE-588)4027808-6 |D g |
689 | 1 | 1 | |a Gesellschaft |0 (DE-588)4020588-5 |D s |
689 | 1 | 2 | |a Krieg |0 (DE-588)4033114-3 |D s |
689 | 1 | 3 | |a Militärsoziologie |0 (DE-588)4169968-3 |D s |
689 | 1 | |5 DE-604 | |
856 | 4 | 2 | |m Digitalisierung UB Bamberg - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=000226316&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
999 | |a oai:aleph.bib-bvb.de:BVB01-000226316 |
Record in the Search Index
_version_ | 1804114828794527744 |
---|---|
adam_text | Contents List of Tables Acknowledgments Preface ix xiii xv PART ONE 1. 2. 3. 4. The State of War and theInterrupted System Institutional Arrangementsof the Interruption Performance of RoutineActivities The Volunteers 3 45 83 119 PART TWO 5. 6. The Routine: Cumulative Influences of the Conflict upon the Civilian System Limitations of This Study and Other Concluding Reflections Methodological Appendix Index 147 191 207 215 vii
List of Tables 1.1 Structured and Unstructured Spheres in the Achievement of the Predominant and Complementary Goals 2.1 Selected Indicators of Economic Activity and Social Processes in Israel 2.2 Shortages of Items, by Place of Residence 2.3 Percentage of People Feeling the Need for Improvement of Public Transportation Services 2.4 Percentage of Respondents Indicating That It Was “Nec essary” or “Very Necessary” to Improve Civilian Services 3.1 Frequency of Performance of Various Activities in Rou tine Situations Compared with Situations of Active War fare and the Differences between Them 3.2 Levels of Significance of the Association between the Frequency of Performance of Various Activities and Ethnic Origin in Routine Periods and in Periods of Social Interruption 3.3 Rates of Stability of Major and Minor Changes in Various Activities and Their Direction between Routine Situa tions and Those of Social Interruption 3.4 Changes in Tendency to Be Absent from Work during the War Compared with Routine Times, by Sex, Ethnic Origin, and Recruitment or Nonrecruitment of Family Members 3.5 Changes in the Proportion of Respondents Listening to the News in Routine vs. Interrupted Periods, by Re cruitment orNonrecruitment of Family Members 3.6 Changes in the Tendency to Stay at Home between Routine and Interrupted Periods, by Self-Definition in Regard to Religion and Readiness to Volunteer in the InterruptedPeriods 3.7 Changes in Frequency of Meeting with Friends between Routine and Interrupted Periods, by Father’s Ethnic Origin ix 27 46 53 55 61 84 85 88 92 96 100 103
л՜ 3.8 3.9 3.10 3.11 3.12 4.1 4.2 4.3 4.4 4.5 4.6 4.7 4.8 4.9 5.1 5.2 List of Tables Changes in Regular Eating Habits between Routine and Interrupted Periods, by Sex Changes in the Tendency to Care for Order and Clean liness in the Home between Routine and Interrupted Periods, by Father’s Ethnic Origin and Attitude toward Religion Changes in the Proportion of Respondents Caring for Personal Appearance between Routine and Interrupted Periods, by Agreement with the Attitude That “when soldiers are falling on the front, there’s no point in doing anything at home” Changes in Prayer Habits between Routine and Inter rupted Periods, by the Existence of a Sense of Anomie and the Desire for a Moratorium in the Period of Interruption Changes in Prayer Habits between Routine and Inter rupted Periods, by Recruitment or Nonrecruitment of Family Members Volunteers Registered through the Employment Service of the Ministry of Labor for Paid Jobs, by Month Population of the Sample, by Volunteering and Selected Background Variables The Sample Population, by Volunteering and Workload during the War The Sample Population, by Volunteering and Political Party Membership Women, by Volunteering and the Age of the Youngest Child in the Household Volunteers, by the Way in Which They Obtained Their Volunteer Jobs Volunteers, by the Connection between Their Volunteer Work and Their Usual Professions Volunteers, by Possession of a Private Vehicle by the Respondent Volunteers, by Outputs of Their Volunteer Work Fatalities in Israel as a Result of the Jewish-Arab Conflict (Wars and Guerrilla Actions),
by Periods and Percentage of the Total Jewish Population Subjective Evaluation of the Probability of Being Killed as a Result of the Israeli-Arab Conflict Compared to the Subjective Evaluation of Being Killed in a Car Accident 103 105 106 113 113 121 125 131 132 133 135 135 137 139 150 152
List of Tables 5.3 5.4 5.5 5.6 5.7 5.8 5.9 5.10 6.1 A. 1 A.2 A.3 A.4 A. 5 Subjective Evaluation of the Probability of the Arabs’ Being Able to Defeat Israel Correlation Coefficients between the General Salience Index of the Jewish-Arab Conflict and the Salience of Use of Forces, by Identity of the Initiator and Suicide Rates in Israel International Comparison of the Tax Burden as a Per centage of the Gross Domestic Product Military Expenditures of Selected Countries, by Man power and Financial Resources Allocation of Economic Resources The Composition of Foreign Aid Percentage of Emigrants of the Total Immigrants, Israel and Selected Countries Israelis’ Readiness to Leave the Country The Fit of the Interrupted System to Characteristics of Stages in the Developmentof Disasters Sex Distribution of Samples Compared with Sex Dis tribution of the Jerusalem Population Distribution by Father’s Continent of Birth in the Sample and in the Jerusalem Population, Age 29 and Over Distribution by Continent of Birth in the Sample and in the Jerusalem Population Distribution of Sample by Age Distribution by Years of Schooling in the Sample and in the Jerusalem Population, Age 14 and Over xi 154 156 164 165 166 167 177 178 195 209 209 211 211 212
|
any_adam_object | 1 |
author | Kimerling, Barukh 1939-2007 |
author_GND | (DE-588)124517234 |
author_facet | Kimerling, Barukh 1939-2007 |
author_role | aut |
author_sort | Kimerling, Barukh 1939-2007 |
author_variant | b k bk |
building | Verbundindex |
bvnumber | BV000364327 |
classification_rvk | MH 84940 |
ctrlnum | (OCoLC)230815681 (DE-599)BVBBV000364327 |
discipline | Politologie |
format | Book |
fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>01770nam a2200433 c 4500</leader><controlfield tag="001">BV000364327</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20200327 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">870612s1985 |||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">0887380204</subfield><subfield code="9">0-88738-020-4</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)230815681</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV000364327</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rakddb</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield><subfield code="a">DE-473</subfield><subfield code="a">DE-706</subfield></datafield><datafield tag="084" ind1=" " ind2=" "><subfield code="a">MH 84940</subfield><subfield code="0">(DE-625)122919:12226</subfield><subfield code="2">rvk</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Kimerling, Barukh</subfield><subfield code="d">1939-2007</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)124517234</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">The interrupted system</subfield><subfield code="b">Israeli civilians in war and routine times</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">New Brunswick (USA) [u.a.]</subfield><subfield code="b">Transaction Books</subfield><subfield code="c">1985</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">XVIII, 219 S.</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Krieg</subfield><subfield code="0">(DE-588)4033114-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Kriegssoziologie</subfield><subfield code="0">(DE-588)4760356-2</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Gesellschaft</subfield><subfield code="0">(DE-588)4020588-5</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Militärsoziologie</subfield><subfield code="0">(DE-588)4169968-3</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="651" ind1=" " ind2="7"><subfield code="a">Israel</subfield><subfield code="0">(DE-588)4027808-6</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Israel</subfield><subfield code="0">(DE-588)4027808-6</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Kriegssoziologie</subfield><subfield code="0">(DE-588)4760356-2</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="689" ind1="1" ind2="0"><subfield code="a">Israel</subfield><subfield code="0">(DE-588)4027808-6</subfield><subfield code="D">g</subfield></datafield><datafield tag="689" ind1="1" ind2="1"><subfield code="a">Gesellschaft</subfield><subfield code="0">(DE-588)4020588-5</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="2"><subfield code="a">Krieg</subfield><subfield code="0">(DE-588)4033114-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2="3"><subfield code="a">Militärsoziologie</subfield><subfield code="0">(DE-588)4169968-3</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="1" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung UB Bamberg - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=000226316&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-000226316</subfield></datafield></record></collection> |
geographic | Israel (DE-588)4027808-6 gnd |
geographic_facet | Israel |
id | DE-604.BV000364327 |
illustrated | Not Illustrated |
indexdate | 2024-07-09T15:12:56Z |
institution | BVB |
isbn | 0887380204 |
language | English |
oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-000226316 |
oclc_num | 230815681 |
open_access_boolean | |
owner | DE-12 DE-473 DE-BY-UBG DE-706 |
owner_facet | DE-12 DE-473 DE-BY-UBG DE-706 |
physical | XVIII, 219 S. |
publishDate | 1985 |
publishDateSearch | 1985 |
publishDateSort | 1985 |
publisher | Transaction Books |
record_format | marc |
spelling | Kimerling, Barukh 1939-2007 Verfasser (DE-588)124517234 aut The interrupted system Israeli civilians in war and routine times New Brunswick (USA) [u.a.] Transaction Books 1985 XVIII, 219 S. txt rdacontent n rdamedia nc rdacarrier Krieg (DE-588)4033114-3 gnd rswk-swf Kriegssoziologie (DE-588)4760356-2 gnd rswk-swf Gesellschaft (DE-588)4020588-5 gnd rswk-swf Militärsoziologie (DE-588)4169968-3 gnd rswk-swf Israel (DE-588)4027808-6 gnd rswk-swf Israel (DE-588)4027808-6 g Kriegssoziologie (DE-588)4760356-2 s DE-604 Gesellschaft (DE-588)4020588-5 s Krieg (DE-588)4033114-3 s Militärsoziologie (DE-588)4169968-3 s Digitalisierung UB Bamberg - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=000226316&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
spellingShingle | Kimerling, Barukh 1939-2007 The interrupted system Israeli civilians in war and routine times Krieg (DE-588)4033114-3 gnd Kriegssoziologie (DE-588)4760356-2 gnd Gesellschaft (DE-588)4020588-5 gnd Militärsoziologie (DE-588)4169968-3 gnd |
subject_GND | (DE-588)4033114-3 (DE-588)4760356-2 (DE-588)4020588-5 (DE-588)4169968-3 (DE-588)4027808-6 |
title | The interrupted system Israeli civilians in war and routine times |
title_auth | The interrupted system Israeli civilians in war and routine times |
title_exact_search | The interrupted system Israeli civilians in war and routine times |
title_full | The interrupted system Israeli civilians in war and routine times |
title_fullStr | The interrupted system Israeli civilians in war and routine times |
title_full_unstemmed | The interrupted system Israeli civilians in war and routine times |
title_short | The interrupted system |
title_sort | the interrupted system israeli civilians in war and routine times |
title_sub | Israeli civilians in war and routine times |
topic | Krieg (DE-588)4033114-3 gnd Kriegssoziologie (DE-588)4760356-2 gnd Gesellschaft (DE-588)4020588-5 gnd Militärsoziologie (DE-588)4169968-3 gnd |
topic_facet | Krieg Kriegssoziologie Gesellschaft Militärsoziologie Israel |
url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=000226316&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
work_keys_str_mv | AT kimerlingbarukh theinterruptedsystemisraeliciviliansinwarandroutinetimes |