Advanced powder technology VIII :: selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil /
This special collection of peer-reviewed papers focuses on the powder technology of metals, ceramics and composites. The 343 papers are grouped into 3 chapters: 1 - Powder Metallurgy; 2 - Ceramics I; 3 - Ceramics II. The topics covered range over powder production, ceramics processing, properties, p...
Gespeichert in:
| Körperschaft: | |
|---|---|
| Weitere Verfasser: | , |
| Format: | Elektronisch Tagungsbericht E-Book |
| Sprache: | English |
| Veröffentlicht: |
[Durnten-Zurich] ; [Enfield, NH] :
Trans Tech Publications,
[2012]
|
| Schriftenreihe: | Materials science forum ;
v. 727-728. |
| Schlagworte: | |
| Online-Zugang: | Volltext |
| Zusammenfassung: | This special collection of peer-reviewed papers focuses on the powder technology of metals, ceramics and composites. The 343 papers are grouped into 3 chapters: 1 - Powder Metallurgy; 2 - Ceramics I; 3 - Ceramics II. The topics covered range over powder production, ceramics processing, properties, powder compaction and sintering, injection moulding and mechanical alloying. A special session dealt with nanomaterials, fuel cells, storage energy materials, biomaterials, sintering atmospheres, PM markets, characterization and applications. Temporary description, more details to follow. |
| Beschreibung: | 1 online resource (1937 pages) : illustrations (some color) |
| Bibliographie: | Includes bibliographical references and indexes. |
| ISBN: | 9783038139065 3038139068 |
| ISSN: | 0255-5476 ; |
Internformat
MARC
| LEADER | 00000cam a2200000 a 4500 | ||
|---|---|---|---|
| 001 | ZDB-4-EBA-ocn840689427 | ||
| 003 | OCoLC | ||
| 005 | 20241004212047.0 | ||
| 006 | m o d | ||
| 007 | cr cnu---unuuu | ||
| 008 | 130424t20122012sz a ob 101 0 eng d | ||
| 040 | |a N$T |b eng |e pn |c N$T |d GZM |d LLB |d E7B |d CUS |d OCLCF |d OCLCO |d OCLCQ |d YDXCP |d EBLCP |d DEBSZ |d OCLCO |d OCL |d OCLCO |d OCLCQ |d OCLCO |d AGLDB |d OCLCQ |d VTS |d STF |d M8D |d OCLCQ |d TTECH |d VLY |d AJS |d OCLCO |d OCLCQ |d OCLCO |d OCLCQ |d OCLCL |d DST |d TNZ |d QGK | ||
| 066 | |c (S | ||
| 019 | |a 818786600 |a 897640954 |a 1162410284 |a 1241951518 |a 1259278087 |a 1300528344 |a 1303321525 |a 1303464442 | ||
| 020 | |a 9783038139065 |q (electronic bk.) | ||
| 020 | |a 3038139068 |q (electronic bk.) | ||
| 020 | |z 9783037854907 | ||
| 020 | |z 3037854901 | ||
| 035 | |a (OCoLC)840689427 |z (OCoLC)818786600 |z (OCoLC)897640954 |z (OCoLC)1162410284 |z (OCoLC)1241951518 |z (OCoLC)1259278087 |z (OCoLC)1300528344 |z (OCoLC)1303321525 |z (OCoLC)1303464442 | ||
| 050 | 4 | |a TN695 | |
| 072 | 7 | |a TEC |x 040000 |2 bisacsh | |
| 082 | 7 | |a 671.3/7 |2 23 | |
| 049 | |a MAIN | ||
| 111 | 2 | |a International Latin-American Conference on Powder Technology |n (8th : |d 2011 : |c Florianópolis, Brazil) | |
| 245 | 1 | 0 | |a Advanced powder technology VIII : |b selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil / |c edited by Lucio Salgado and Francisco Ambrozio Filho. |
| 246 | 3 | 0 | |a Advanced powder technology 8 |
| 246 | 3 | 0 | |a Advanced powder technology eight |
| 246 | 3 | 0 | |a Eighth Latin American Conference on Powder Technology |
| 246 | 3 | 0 | |a Latin American Conference on Powder Technology |
| 264 | 1 | |a [Durnten-Zurich] ; |a [Enfield, NH] : |b Trans Tech Publications, |c [2012] | |
| 264 | 4 | |c ©2102 | |
| 300 | |a 1 online resource (1937 pages) : |b illustrations (some color) | ||
| 336 | |a text |b txt |2 rdacontent | ||
| 337 | |a computer |b c |2 rdamedia | ||
| 338 | |a online resource |b cr |2 rdacarrier | ||
| 490 | 1 | |a Materials science forum, |x 0255-5476 ; |v vols. 727-728 | |
| 504 | |a Includes bibliographical references and indexes. | ||
| 588 | 0 | |a Print version record. | |
| 520 | |a This special collection of peer-reviewed papers focuses on the powder technology of metals, ceramics and composites. The 343 papers are grouped into 3 chapters: 1 - Powder Metallurgy; 2 - Ceramics I; 3 - Ceramics II. The topics covered range over powder production, ceramics processing, properties, powder compaction and sintering, injection moulding and mechanical alloying. A special session dealt with nanomaterials, fuel cells, storage energy materials, biomaterials, sintering atmospheres, PM markets, characterization and applications. Temporary description, more details to follow. | ||
| 505 | 0 | |a Advanced Powder Technology VIII; Committees and Foreword; Table of Contents; Chapter 1: Powder Metallurgy; Structural Comparison of Amorphous, Nanocrystalline and Microcrystalline Al90Fe7Nb3 Alloys; Synthesis of Powders Nanometer Al2O3 Method by Sol-Gel; Nickel Electrodeposition over Powder Compact for Irradiation Target; Analysis of the Use of a Filtering Medium in Different Parts of a Centrifugal Separator; Three-Dimensional Reconstruction of the Porosity of Pellets of Iron Oxide and Coal Powders by Serial Sectioning. | |
| 505 | 8 | |a Preparation and Characterization: The Effect of Incorporation by Ion Exchange of Pt, Ni and Ru on a H-ZSM5 ZeoliteTiN/ZrN Multilayer PVD Coatings on Titanium Alloys Produced by Powder Metallurgy; Production of Aerospace Tial Intermetallics for High Temperature Applications by Powder Metallurgy; Microstructural Analysis of Ti-6Al-4V Alloy after Plasma Immersion Ion Implantation (PIII); The Influence of Zinc Doping on the Grain Size and Productivity of Diamond Synthesis in the Ni-Mn-C System at High Pressure and High Temperature. | |
| 505 | 8 | |6 880-01 |a Effect of Passivation Treatments on the Corrosion Resistance of PIM 316L Stainless Steel in a PEM Fuel Cell Simulated EnvironmentProduction of Ti-13Nb-13Zr Alloy by PM for Biomedical Applications Using Zirconium Oxide Grinding Bowl and Balls; Thermogravimetric Study of the Oxidation Behaviour of Sintered Stainless Steels: Influence of Powder Size and Composition; Utilization of Solar Energy as Heat Source; A Simple Algorithm for the Calculation of Hysteresis for Isotropic NdFeB Magnets; Study of Carbon Influence on Magnetic Properties of Metal Injection Molding Nd-Fe-B Based Magnets. | |
| 505 | 8 | |a A Model for the Hysteresis Curves of Soft Magnetic MaterialsEBSD Texture Analysis of NdFeB Magnets; One Domain Wall Hysteresis Model for Spherical Grain; Modeling the Heat Treatment of Dy-Diffused Nd2Fe14B Magnets: The Shell Model; Nucleus Size Determination for Nd2Fe14B, Sm2Co17, SmCo5 and BaFe12O19 Magnets; A General Coercivity Model for Soft Magnetic Materials; Diffusion Coefficients of Interest for the Simulation of Heat Treatment in Rare-Earth Transition Metal Magnets; The Samarium Depleted Zone in SmCo5 Magnets; Modeling the Densification of FeSi Sintered Magnetic Alloys. | |
| 546 | |a English. | ||
| 650 | 0 | |a Powder metallurgy |v Congresses. | |
| 650 | 0 | |a Ceramic powders |v Congresses. | |
| 650 | 6 | |a Métallurgie des poudres |v Congrès. | |
| 650 | 6 | |a Poudres céramiques |v Congrès. | |
| 650 | 7 | |a TECHNOLOGY & ENGINEERING |x Technical & Manufacturing Industries & Trades. |2 bisacsh | |
| 650 | 7 | |a Ceramic powders |2 fast | |
| 650 | 7 | |a Powder metallurgy |2 fast | |
| 653 | 1 | |a Powder technology | |
| 655 | 7 | |a Conference papers and proceedings |2 fast | |
| 700 | 1 | |a Salgado, Lucio, |e editor. | |
| 700 | 1 | |a Ambrozio Filho, Francisco, |e editor. | |
| 758 | |i has work: |a Advanced Powder Technology VIII (Text) |1 https://id.oclc.org/worldcat/entity/E39PD3TqQkXx3CbYdkPhyrhHvd |4 https://id.oclc.org/worldcat/ontology/hasWork | ||
| 776 | 0 | 8 | |i Print version: |a International Latin-American Conference on Powder Technology (8th : 2011 : Florianópolis, Brazil). |t Advanced powder technology VIII. |d Durnten-Zurich ; Enfield, NH : Trans Tech Publications, [2012] |z 9783037854907 |w (DLC) 2012540898 |w (OCoLC)813853672 |
| 830 | 0 | |a Materials science forum ; |v v. 727-728. |0 http://id.loc.gov/authorities/names/no94007967 | |
| 856 | 4 | 0 | |l FWS01 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517287 |3 Volltext |
| 880 | 8 | |6 505-01/(S |a Processing and Characterization of β-Ti Alloys by Means of Powder Metallurgy Processing and Blender ElementalThree-Dimensional Stochastic Modeling and X-Ray Microtomography Applied to Titanium Scaffolds: A Comparative Approach; Fatigue Strength of Ti-35Nb-7Zr-5Ta; Microstructure and Electrochemical Properties of a LaMgAlMnCoNi Based Alloy for Ni/MH Batteries; Effect of the Sintering Atmosphere on the Corrosion Resistance of Titanium for Application as Biomaterial; Sintering of AISI M2 High Speed Steel with the Addition of NbC. | |
| 938 | |a Trans Tech Publications, Ltd |b TRAN |n 10.4028/www.scientific.net/MSF.727-728 | ||
| 938 | |a ProQuest Ebook Central |b EBLB |n EBL1872944 | ||
| 938 | |a ebrary |b EBRY |n ebr10777941 | ||
| 938 | |a EBSCOhost |b EBSC |n 517287 | ||
| 938 | |a YBP Library Services |b YANK |n 9968230 | ||
| 994 | |a 92 |b GEBAY | ||
| 912 | |a ZDB-4-EBA | ||
| 049 | |a DE-863 | ||
Datensatz im Suchindex
| DE-BY-FWS_katkey | ZDB-4-EBA-ocn840689427 |
|---|---|
| _version_ | 1816882230190931968 |
| adam_text | |
| any_adam_object | |
| author2 | Salgado, Lucio Ambrozio Filho, Francisco |
| author2_role | edt edt |
| author2_variant | l s ls f f a ff ffa |
| author_corporate | International Latin-American Conference on Powder Technology Florianópolis, Brazil |
| author_corporate_role | |
| author_facet | Salgado, Lucio Ambrozio Filho, Francisco International Latin-American Conference on Powder Technology Florianópolis, Brazil |
| author_sort | International Latin-American Conference on Powder Technology Florianópolis, Brazil |
| building | Verbundindex |
| bvnumber | localFWS |
| callnumber-first | T - Technology |
| callnumber-label | TN695 |
| callnumber-raw | TN695 |
| callnumber-search | TN695 |
| callnumber-sort | TN 3695 |
| callnumber-subject | TN - Mining Engineering and Metallurgy |
| collection | ZDB-4-EBA |
| contents | Advanced Powder Technology VIII; Committees and Foreword; Table of Contents; Chapter 1: Powder Metallurgy; Structural Comparison of Amorphous, Nanocrystalline and Microcrystalline Al90Fe7Nb3 Alloys; Synthesis of Powders Nanometer Al2O3 Method by Sol-Gel; Nickel Electrodeposition over Powder Compact for Irradiation Target; Analysis of the Use of a Filtering Medium in Different Parts of a Centrifugal Separator; Three-Dimensional Reconstruction of the Porosity of Pellets of Iron Oxide and Coal Powders by Serial Sectioning. Preparation and Characterization: The Effect of Incorporation by Ion Exchange of Pt, Ni and Ru on a H-ZSM5 ZeoliteTiN/ZrN Multilayer PVD Coatings on Titanium Alloys Produced by Powder Metallurgy; Production of Aerospace Tial Intermetallics for High Temperature Applications by Powder Metallurgy; Microstructural Analysis of Ti-6Al-4V Alloy after Plasma Immersion Ion Implantation (PIII); The Influence of Zinc Doping on the Grain Size and Productivity of Diamond Synthesis in the Ni-Mn-C System at High Pressure and High Temperature. Effect of Passivation Treatments on the Corrosion Resistance of PIM 316L Stainless Steel in a PEM Fuel Cell Simulated EnvironmentProduction of Ti-13Nb-13Zr Alloy by PM for Biomedical Applications Using Zirconium Oxide Grinding Bowl and Balls; Thermogravimetric Study of the Oxidation Behaviour of Sintered Stainless Steels: Influence of Powder Size and Composition; Utilization of Solar Energy as Heat Source; A Simple Algorithm for the Calculation of Hysteresis for Isotropic NdFeB Magnets; Study of Carbon Influence on Magnetic Properties of Metal Injection Molding Nd-Fe-B Based Magnets. A Model for the Hysteresis Curves of Soft Magnetic MaterialsEBSD Texture Analysis of NdFeB Magnets; One Domain Wall Hysteresis Model for Spherical Grain; Modeling the Heat Treatment of Dy-Diffused Nd2Fe14B Magnets: The Shell Model; Nucleus Size Determination for Nd2Fe14B, Sm2Co17, SmCo5 and BaFe12O19 Magnets; A General Coercivity Model for Soft Magnetic Materials; Diffusion Coefficients of Interest for the Simulation of Heat Treatment in Rare-Earth Transition Metal Magnets; The Samarium Depleted Zone in SmCo5 Magnets; Modeling the Densification of FeSi Sintered Magnetic Alloys. |
| ctrlnum | (OCoLC)840689427 |
| dewey-full | 671.3/7 |
| dewey-hundreds | 600 - Technology (Applied sciences) |
| dewey-ones | 671 - Metalworking & primary metal products |
| dewey-raw | 671.3/7 |
| dewey-search | 671.3/7 |
| dewey-sort | 3671.3 17 |
| dewey-tens | 670 - Manufacturing |
| discipline | Werkstoffwissenschaften / Fertigungstechnik |
| format | Electronic Conference Proceeding eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>07107cam a2200757 a 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn840689427</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20241004212047.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cnu---unuuu</controlfield><controlfield tag="008">130424t20122012sz a ob 101 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">N$T</subfield><subfield code="b">eng</subfield><subfield code="e">pn</subfield><subfield code="c">N$T</subfield><subfield code="d">GZM</subfield><subfield code="d">LLB</subfield><subfield code="d">E7B</subfield><subfield code="d">CUS</subfield><subfield code="d">OCLCF</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">YDXCP</subfield><subfield code="d">EBLCP</subfield><subfield code="d">DEBSZ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCL</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">AGLDB</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VTS</subfield><subfield code="d">STF</subfield><subfield code="d">M8D</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">TTECH</subfield><subfield code="d">VLY</subfield><subfield code="d">AJS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCL</subfield><subfield code="d">DST</subfield><subfield code="d">TNZ</subfield><subfield code="d">QGK</subfield></datafield><datafield tag="066" ind1=" " ind2=" "><subfield code="c">(S</subfield></datafield><datafield tag="019" ind1=" " ind2=" "><subfield code="a">818786600</subfield><subfield code="a">897640954</subfield><subfield code="a">1162410284</subfield><subfield code="a">1241951518</subfield><subfield code="a">1259278087</subfield><subfield code="a">1300528344</subfield><subfield code="a">1303321525</subfield><subfield code="a">1303464442</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038139065</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038139068</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9783037854907</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">3037854901</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)840689427</subfield><subfield code="z">(OCoLC)818786600</subfield><subfield code="z">(OCoLC)897640954</subfield><subfield code="z">(OCoLC)1162410284</subfield><subfield code="z">(OCoLC)1241951518</subfield><subfield code="z">(OCoLC)1259278087</subfield><subfield code="z">(OCoLC)1300528344</subfield><subfield code="z">(OCoLC)1303321525</subfield><subfield code="z">(OCoLC)1303464442</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">TN695</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">TEC</subfield><subfield code="x">040000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">671.3/7</subfield><subfield code="2">23</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Latin-American Conference on Powder Technology</subfield><subfield code="n">(8th :</subfield><subfield code="d">2011 :</subfield><subfield code="c">Florianópolis, Brazil)</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Advanced powder technology VIII :</subfield><subfield code="b">selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil /</subfield><subfield code="c">edited by Lucio Salgado and Francisco Ambrozio Filho.</subfield></datafield><datafield tag="246" ind1="3" ind2="0"><subfield code="a">Advanced powder technology 8</subfield></datafield><datafield tag="246" ind1="3" ind2="0"><subfield code="a">Advanced powder technology eight</subfield></datafield><datafield tag="246" ind1="3" ind2="0"><subfield code="a">Eighth Latin American Conference on Powder Technology</subfield></datafield><datafield tag="246" ind1="3" ind2="0"><subfield code="a">Latin American Conference on Powder Technology</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">[Durnten-Zurich] ;</subfield><subfield code="a">[Enfield, NH] :</subfield><subfield code="b">Trans Tech Publications,</subfield><subfield code="c">[2012]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">©2102</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (1937 pages) :</subfield><subfield code="b">illustrations (some color)</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Materials science forum,</subfield><subfield code="x">0255-5476 ;</subfield><subfield code="v">vols. 727-728</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references and indexes.</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Print version record.</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">This special collection of peer-reviewed papers focuses on the powder technology of metals, ceramics and composites. The 343 papers are grouped into 3 chapters: 1 - Powder Metallurgy; 2 - Ceramics I; 3 - Ceramics II. The topics covered range over powder production, ceramics processing, properties, powder compaction and sintering, injection moulding and mechanical alloying. A special session dealt with nanomaterials, fuel cells, storage energy materials, biomaterials, sintering atmospheres, PM markets, characterization and applications. Temporary description, more details to follow.</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Advanced Powder Technology VIII; Committees and Foreword; Table of Contents; Chapter 1: Powder Metallurgy; Structural Comparison of Amorphous, Nanocrystalline and Microcrystalline Al90Fe7Nb3 Alloys; Synthesis of Powders Nanometer Al2O3 Method by Sol-Gel; Nickel Electrodeposition over Powder Compact for Irradiation Target; Analysis of the Use of a Filtering Medium in Different Parts of a Centrifugal Separator; Three-Dimensional Reconstruction of the Porosity of Pellets of Iron Oxide and Coal Powders by Serial Sectioning.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Preparation and Characterization: The Effect of Incorporation by Ion Exchange of Pt, Ni and Ru on a H-ZSM5 ZeoliteTiN/ZrN Multilayer PVD Coatings on Titanium Alloys Produced by Powder Metallurgy; Production of Aerospace Tial Intermetallics for High Temperature Applications by Powder Metallurgy; Microstructural Analysis of Ti-6Al-4V Alloy after Plasma Immersion Ion Implantation (PIII); The Influence of Zinc Doping on the Grain Size and Productivity of Diamond Synthesis in the Ni-Mn-C System at High Pressure and High Temperature.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="6">880-01</subfield><subfield code="a">Effect of Passivation Treatments on the Corrosion Resistance of PIM 316L Stainless Steel in a PEM Fuel Cell Simulated EnvironmentProduction of Ti-13Nb-13Zr Alloy by PM for Biomedical Applications Using Zirconium Oxide Grinding Bowl and Balls; Thermogravimetric Study of the Oxidation Behaviour of Sintered Stainless Steels: Influence of Powder Size and Composition; Utilization of Solar Energy as Heat Source; A Simple Algorithm for the Calculation of Hysteresis for Isotropic NdFeB Magnets; Study of Carbon Influence on Magnetic Properties of Metal Injection Molding Nd-Fe-B Based Magnets.</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">A Model for the Hysteresis Curves of Soft Magnetic MaterialsEBSD Texture Analysis of NdFeB Magnets; One Domain Wall Hysteresis Model for Spherical Grain; Modeling the Heat Treatment of Dy-Diffused Nd2Fe14B Magnets: The Shell Model; Nucleus Size Determination for Nd2Fe14B, Sm2Co17, SmCo5 and BaFe12O19 Magnets; A General Coercivity Model for Soft Magnetic Materials; Diffusion Coefficients of Interest for the Simulation of Heat Treatment in Rare-Earth Transition Metal Magnets; The Samarium Depleted Zone in SmCo5 Magnets; Modeling the Densification of FeSi Sintered Magnetic Alloys.</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">English.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Powder metallurgy</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Ceramic powders</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Métallurgie des poudres</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Poudres céramiques</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">TECHNOLOGY & ENGINEERING</subfield><subfield code="x">Technical & Manufacturing Industries & Trades.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Ceramic powders</subfield><subfield code="2">fast</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Powder metallurgy</subfield><subfield code="2">fast</subfield></datafield><datafield tag="653" ind1="1" ind2=" "><subfield code="a">Powder technology</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Salgado, Lucio,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Ambrozio Filho, Francisco,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="758" ind1=" " ind2=" "><subfield code="i">has work:</subfield><subfield code="a">Advanced Powder Technology VIII (Text)</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PD3TqQkXx3CbYdkPhyrhHvd</subfield><subfield code="4">https://id.oclc.org/worldcat/ontology/hasWork</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="a">International Latin-American Conference on Powder Technology (8th : 2011 : Florianópolis, Brazil).</subfield><subfield code="t">Advanced powder technology VIII.</subfield><subfield code="d">Durnten-Zurich ; Enfield, NH : Trans Tech Publications, [2012]</subfield><subfield code="z">9783037854907</subfield><subfield code="w">(DLC) 2012540898</subfield><subfield code="w">(OCoLC)813853672</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Materials science forum ;</subfield><subfield code="v">v. 727-728.</subfield><subfield code="0">http://id.loc.gov/authorities/names/no94007967</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="l">FWS01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517287</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="880" ind1="8" ind2=" "><subfield code="6">505-01/(S</subfield><subfield code="a">Processing and Characterization of β-Ti Alloys by Means of Powder Metallurgy Processing and Blender ElementalThree-Dimensional Stochastic Modeling and X-Ray Microtomography Applied to Titanium Scaffolds: A Comparative Approach; Fatigue Strength of Ti-35Nb-7Zr-5Ta; Microstructure and Electrochemical Properties of a LaMgAlMnCoNi Based Alloy for Ni/MH Batteries; Effect of the Sintering Atmosphere on the Corrosion Resistance of Titanium for Application as Biomaterial; Sintering of AISI M2 High Speed Steel with the Addition of NbC.</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">Trans Tech Publications, Ltd</subfield><subfield code="b">TRAN</subfield><subfield code="n">10.4028/www.scientific.net/MSF.727-728</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ProQuest Ebook Central</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL1872944</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ebrary</subfield><subfield code="b">EBRY</subfield><subfield code="n">ebr10777941</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">517287</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">9968230</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-863</subfield></datafield></record></collection> |
| genre | Conference papers and proceedings fast |
| genre_facet | Conference papers and proceedings |
| id | ZDB-4-EBA-ocn840689427 |
| illustrated | Illustrated |
| indexdate | 2024-11-27T13:25:18Z |
| institution | BVB |
| isbn | 9783038139065 3038139068 |
| issn | 0255-5476 ; |
| language | English |
| oclc_num | 840689427 |
| open_access_boolean | |
| owner | MAIN DE-863 DE-BY-FWS |
| owner_facet | MAIN DE-863 DE-BY-FWS |
| physical | 1 online resource (1937 pages) : illustrations (some color) |
| psigel | ZDB-4-EBA |
| publishDate | 2012 |
| publishDateSearch | 2012 |
| publishDateSort | 2012 |
| publisher | Trans Tech Publications, |
| record_format | marc |
| series | Materials science forum ; |
| series2 | Materials science forum, |
| spelling | International Latin-American Conference on Powder Technology (8th : 2011 : Florianópolis, Brazil) Advanced powder technology VIII : selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil / edited by Lucio Salgado and Francisco Ambrozio Filho. Advanced powder technology 8 Advanced powder technology eight Eighth Latin American Conference on Powder Technology Latin American Conference on Powder Technology [Durnten-Zurich] ; [Enfield, NH] : Trans Tech Publications, [2012] ©2102 1 online resource (1937 pages) : illustrations (some color) text txt rdacontent computer c rdamedia online resource cr rdacarrier Materials science forum, 0255-5476 ; vols. 727-728 Includes bibliographical references and indexes. Print version record. This special collection of peer-reviewed papers focuses on the powder technology of metals, ceramics and composites. The 343 papers are grouped into 3 chapters: 1 - Powder Metallurgy; 2 - Ceramics I; 3 - Ceramics II. The topics covered range over powder production, ceramics processing, properties, powder compaction and sintering, injection moulding and mechanical alloying. A special session dealt with nanomaterials, fuel cells, storage energy materials, biomaterials, sintering atmospheres, PM markets, characterization and applications. Temporary description, more details to follow. Advanced Powder Technology VIII; Committees and Foreword; Table of Contents; Chapter 1: Powder Metallurgy; Structural Comparison of Amorphous, Nanocrystalline and Microcrystalline Al90Fe7Nb3 Alloys; Synthesis of Powders Nanometer Al2O3 Method by Sol-Gel; Nickel Electrodeposition over Powder Compact for Irradiation Target; Analysis of the Use of a Filtering Medium in Different Parts of a Centrifugal Separator; Three-Dimensional Reconstruction of the Porosity of Pellets of Iron Oxide and Coal Powders by Serial Sectioning. Preparation and Characterization: The Effect of Incorporation by Ion Exchange of Pt, Ni and Ru on a H-ZSM5 ZeoliteTiN/ZrN Multilayer PVD Coatings on Titanium Alloys Produced by Powder Metallurgy; Production of Aerospace Tial Intermetallics for High Temperature Applications by Powder Metallurgy; Microstructural Analysis of Ti-6Al-4V Alloy after Plasma Immersion Ion Implantation (PIII); The Influence of Zinc Doping on the Grain Size and Productivity of Diamond Synthesis in the Ni-Mn-C System at High Pressure and High Temperature. 880-01 Effect of Passivation Treatments on the Corrosion Resistance of PIM 316L Stainless Steel in a PEM Fuel Cell Simulated EnvironmentProduction of Ti-13Nb-13Zr Alloy by PM for Biomedical Applications Using Zirconium Oxide Grinding Bowl and Balls; Thermogravimetric Study of the Oxidation Behaviour of Sintered Stainless Steels: Influence of Powder Size and Composition; Utilization of Solar Energy as Heat Source; A Simple Algorithm for the Calculation of Hysteresis for Isotropic NdFeB Magnets; Study of Carbon Influence on Magnetic Properties of Metal Injection Molding Nd-Fe-B Based Magnets. A Model for the Hysteresis Curves of Soft Magnetic MaterialsEBSD Texture Analysis of NdFeB Magnets; One Domain Wall Hysteresis Model for Spherical Grain; Modeling the Heat Treatment of Dy-Diffused Nd2Fe14B Magnets: The Shell Model; Nucleus Size Determination for Nd2Fe14B, Sm2Co17, SmCo5 and BaFe12O19 Magnets; A General Coercivity Model for Soft Magnetic Materials; Diffusion Coefficients of Interest for the Simulation of Heat Treatment in Rare-Earth Transition Metal Magnets; The Samarium Depleted Zone in SmCo5 Magnets; Modeling the Densification of FeSi Sintered Magnetic Alloys. English. Powder metallurgy Congresses. Ceramic powders Congresses. Métallurgie des poudres Congrès. Poudres céramiques Congrès. TECHNOLOGY & ENGINEERING Technical & Manufacturing Industries & Trades. bisacsh Ceramic powders fast Powder metallurgy fast Powder technology Conference papers and proceedings fast Salgado, Lucio, editor. Ambrozio Filho, Francisco, editor. has work: Advanced Powder Technology VIII (Text) https://id.oclc.org/worldcat/entity/E39PD3TqQkXx3CbYdkPhyrhHvd https://id.oclc.org/worldcat/ontology/hasWork Print version: International Latin-American Conference on Powder Technology (8th : 2011 : Florianópolis, Brazil). Advanced powder technology VIII. Durnten-Zurich ; Enfield, NH : Trans Tech Publications, [2012] 9783037854907 (DLC) 2012540898 (OCoLC)813853672 Materials science forum ; v. 727-728. http://id.loc.gov/authorities/names/no94007967 FWS01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517287 Volltext 505-01/(S Processing and Characterization of β-Ti Alloys by Means of Powder Metallurgy Processing and Blender ElementalThree-Dimensional Stochastic Modeling and X-Ray Microtomography Applied to Titanium Scaffolds: A Comparative Approach; Fatigue Strength of Ti-35Nb-7Zr-5Ta; Microstructure and Electrochemical Properties of a LaMgAlMnCoNi Based Alloy for Ni/MH Batteries; Effect of the Sintering Atmosphere on the Corrosion Resistance of Titanium for Application as Biomaterial; Sintering of AISI M2 High Speed Steel with the Addition of NbC. |
| spellingShingle | Advanced powder technology VIII : selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil / Materials science forum ; Advanced Powder Technology VIII; Committees and Foreword; Table of Contents; Chapter 1: Powder Metallurgy; Structural Comparison of Amorphous, Nanocrystalline and Microcrystalline Al90Fe7Nb3 Alloys; Synthesis of Powders Nanometer Al2O3 Method by Sol-Gel; Nickel Electrodeposition over Powder Compact for Irradiation Target; Analysis of the Use of a Filtering Medium in Different Parts of a Centrifugal Separator; Three-Dimensional Reconstruction of the Porosity of Pellets of Iron Oxide and Coal Powders by Serial Sectioning. Preparation and Characterization: The Effect of Incorporation by Ion Exchange of Pt, Ni and Ru on a H-ZSM5 ZeoliteTiN/ZrN Multilayer PVD Coatings on Titanium Alloys Produced by Powder Metallurgy; Production of Aerospace Tial Intermetallics for High Temperature Applications by Powder Metallurgy; Microstructural Analysis of Ti-6Al-4V Alloy after Plasma Immersion Ion Implantation (PIII); The Influence of Zinc Doping on the Grain Size and Productivity of Diamond Synthesis in the Ni-Mn-C System at High Pressure and High Temperature. Effect of Passivation Treatments on the Corrosion Resistance of PIM 316L Stainless Steel in a PEM Fuel Cell Simulated EnvironmentProduction of Ti-13Nb-13Zr Alloy by PM for Biomedical Applications Using Zirconium Oxide Grinding Bowl and Balls; Thermogravimetric Study of the Oxidation Behaviour of Sintered Stainless Steels: Influence of Powder Size and Composition; Utilization of Solar Energy as Heat Source; A Simple Algorithm for the Calculation of Hysteresis for Isotropic NdFeB Magnets; Study of Carbon Influence on Magnetic Properties of Metal Injection Molding Nd-Fe-B Based Magnets. A Model for the Hysteresis Curves of Soft Magnetic MaterialsEBSD Texture Analysis of NdFeB Magnets; One Domain Wall Hysteresis Model for Spherical Grain; Modeling the Heat Treatment of Dy-Diffused Nd2Fe14B Magnets: The Shell Model; Nucleus Size Determination for Nd2Fe14B, Sm2Co17, SmCo5 and BaFe12O19 Magnets; A General Coercivity Model for Soft Magnetic Materials; Diffusion Coefficients of Interest for the Simulation of Heat Treatment in Rare-Earth Transition Metal Magnets; The Samarium Depleted Zone in SmCo5 Magnets; Modeling the Densification of FeSi Sintered Magnetic Alloys. Powder metallurgy Congresses. Ceramic powders Congresses. Métallurgie des poudres Congrès. Poudres céramiques Congrès. TECHNOLOGY & ENGINEERING Technical & Manufacturing Industries & Trades. bisacsh Ceramic powders fast Powder metallurgy fast |
| title | Advanced powder technology VIII : selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil / |
| title_alt | Advanced powder technology 8 Advanced powder technology eight Eighth Latin American Conference on Powder Technology Latin American Conference on Powder Technology |
| title_auth | Advanced powder technology VIII : selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil / |
| title_exact_search | Advanced powder technology VIII : selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil / |
| title_full | Advanced powder technology VIII : selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil / edited by Lucio Salgado and Francisco Ambrozio Filho. |
| title_fullStr | Advanced powder technology VIII : selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil / edited by Lucio Salgado and Francisco Ambrozio Filho. |
| title_full_unstemmed | Advanced powder technology VIII : selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil / edited by Lucio Salgado and Francisco Ambrozio Filho. |
| title_short | Advanced powder technology VIII : |
| title_sort | advanced powder technology viii selected peer reviewed papers from the eighth latin american conference on powder technology november 6 9 2011 florianopolis brazil |
| title_sub | selected, peer reviewed papers from the Eighth Latin American Conference on Powder Technology, November 6-9, 2011, Florianópolis, Brazil / |
| topic | Powder metallurgy Congresses. Ceramic powders Congresses. Métallurgie des poudres Congrès. Poudres céramiques Congrès. TECHNOLOGY & ENGINEERING Technical & Manufacturing Industries & Trades. bisacsh Ceramic powders fast Powder metallurgy fast |
| topic_facet | Powder metallurgy Congresses. Ceramic powders Congresses. Métallurgie des poudres Congrès. Poudres céramiques Congrès. TECHNOLOGY & ENGINEERING Technical & Manufacturing Industries & Trades. Ceramic powders Powder metallurgy Conference papers and proceedings |
| url | https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=517287 |
| work_keys_str_mv | AT internationallatinamericanconferenceonpowdertechnologyflorianopolisbrazil advancedpowdertechnologyviiiselectedpeerreviewedpapersfromtheeighthlatinamericanconferenceonpowdertechnologynovember692011florianopolisbrazil AT salgadolucio advancedpowdertechnologyviiiselectedpeerreviewedpapersfromtheeighthlatinamericanconferenceonpowdertechnologynovember692011florianopolisbrazil AT ambroziofilhofrancisco advancedpowdertechnologyviiiselectedpeerreviewedpapersfromtheeighthlatinamericanconferenceonpowdertechnologynovember692011florianopolisbrazil AT internationallatinamericanconferenceonpowdertechnologyflorianopolisbrazil advancedpowdertechnology8 AT salgadolucio advancedpowdertechnology8 AT ambroziofilhofrancisco advancedpowdertechnology8 AT internationallatinamericanconferenceonpowdertechnologyflorianopolisbrazil advancedpowdertechnologyeight AT salgadolucio advancedpowdertechnologyeight AT ambroziofilhofrancisco advancedpowdertechnologyeight AT internationallatinamericanconferenceonpowdertechnologyflorianopolisbrazil eighthlatinamericanconferenceonpowdertechnology AT salgadolucio eighthlatinamericanconferenceonpowdertechnology AT ambroziofilhofrancisco eighthlatinamericanconferenceonpowdertechnology AT internationallatinamericanconferenceonpowdertechnologyflorianopolisbrazil latinamericanconferenceonpowdertechnology AT salgadolucio latinamericanconferenceonpowdertechnology AT ambroziofilhofrancisco latinamericanconferenceonpowdertechnology |