Solid state science and technology IV :: selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia /
Collection of selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology, December 18-20, 2013, Melaka, Malaysia. The 105 papers are grouped as follows: Chapter 1: Thin Film and Nanostructure, Chapter 2: Superconductors, Chapter 3: Biomaterials Based M...
Gespeichert in:
| Körperschaft: | |
|---|---|
| Weitere Verfasser: | , , |
| Format: | Elektronisch Tagungsbericht E-Book |
| Sprache: | English |
| Veröffentlicht: |
Zurich, Switzerland :
Trans Tech Publications,
[2014]
|
| Schriftenreihe: | Advanced materials research ;
v. 895. |
| Schlagworte: | |
| Online-Zugang: | Volltext |
| Zusammenfassung: | Collection of selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology, December 18-20, 2013, Melaka, Malaysia. The 105 papers are grouped as follows: Chapter 1: Thin Film and Nanostructure, Chapter 2: Superconductors, Chapter 3: Biomaterials Based Molecular Electronics, Chapter 4: Polymers and Composites, Chapter 5: Optical and Dielectric Materials, Chapter 6: Magnetic Materials, Chapter 7: Ceramics and Glasses, Chapter 8: Solid State Theory, Simulations and Computation, Chapter 9: Carbon and Related Materials, Chapter 10: Semiconductors and Devices, Chapter 11: Metals and Alloys Keyword: Thin Film, superconductor, semiconductor, dielectric materials, magnetic materilas, ceramics, glasses. |
| Beschreibung: | 1 online resource (586 pages) : illustrations (some color), graphs, photographs |
| Bibliographie: | Includes bibliographical references at the end of each chapters and indexes. |
| ISBN: | 9783038264149 3038264148 |
| ISSN: | 1662-8985 ; 1662-8985 |
Internformat
MARC
| LEADER | 00000cam a2200000 i 4500 | ||
|---|---|---|---|
| 001 | ZDB-4-EBA-ocn878138257 | ||
| 003 | OCoLC | ||
| 005 | 20241004212047.0 | ||
| 006 | m o d | ||
| 007 | cr cn||||||||| | ||
| 008 | 140322t20142014sz ao ob 101 0 eng d | ||
| 040 | |a E7B |b eng |e rda |e pn |c E7B |d CUS |d OCLCO |d N$T |d OCLCO |d UKMGB |d OCLCF |d EBLCP |d YDXCP |d DEBSZ |d OCLCO |d OCLCQ |d OCLCO |d LLB |d OCL |d DXU |d OCLCO |d OCL |d OCLCO |d AGLDB |d CCO |d PIFBY |d ZCU |d MERUC |d U3W |d STF |d OCLCQ |d VTS |d ICG |d INT |d VT2 |d OCLCQ |d TKN |d OCLCQ |d DKC |d AU@ |d OCLCQ |d M8D |d OCLCQ |d OCL |d HS0 |d OCLCQ |d TTECH |d OCLCO |d OCLCQ |d QGK |d SFB |d OCLCO |d OCLCL | ||
| 016 | 7 | |a 016788834 |2 Uk | |
| 019 | |a 927293181 |a 961584665 |a 962669729 |a 1259264188 | ||
| 020 | |a 9783038264149 |q (electronic bk.) | ||
| 020 | |a 3038264148 |q (electronic bk.) | ||
| 020 | |z 9783038350330 | ||
| 035 | |a (OCoLC)878138257 |z (OCoLC)927293181 |z (OCoLC)961584665 |z (OCoLC)962669729 |z (OCoLC)1259264188 | ||
| 050 | 4 | |a QC176.A1 |b .S655 2014eb | |
| 072 | 7 | |a SCI |x 024000 |2 bisacsh | |
| 072 | 7 | |a SCI |x 041000 |2 bisacsh | |
| 072 | 7 | |a SCI |x 055000 |2 bisacsh | |
| 082 | 7 | |a 530.41 |2 23 | |
| 049 | |a MAIN | ||
| 111 | 2 | |a International Conference on Solid State Science and Technology |n (4th : |d 2012 : |c Melaka, Malaysia) | |
| 245 | 1 | 0 | |a Solid state science and technology IV : |b selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia / |c edited by Huang Nay Ming, Saadah Abd Rahman and Woon Kai Lin. |
| 264 | 1 | |a Zurich, Switzerland : |b Trans Tech Publications, |c [2014] | |
| 264 | 4 | |c ©2014 | |
| 300 | |a 1 online resource (586 pages) : |b illustrations (some color), graphs, photographs | ||
| 336 | |a text |b txt |2 rdacontent | ||
| 337 | |a computer |b c |2 rdamedia | ||
| 338 | |a online resource |b cr |2 rdacarrier | ||
| 490 | 1 | |a Advanced Materials Research, |x 1662-8985 ; |v Vol. 895 | |
| 504 | |a Includes bibliographical references at the end of each chapters and indexes. | ||
| 588 | 0 | |a Online resource; title from PDF title page (ebrary, viewed March 20, 2014). | |
| 520 | |a Collection of selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology, December 18-20, 2013, Melaka, Malaysia. The 105 papers are grouped as follows: Chapter 1: Thin Film and Nanostructure, Chapter 2: Superconductors, Chapter 3: Biomaterials Based Molecular Electronics, Chapter 4: Polymers and Composites, Chapter 5: Optical and Dielectric Materials, Chapter 6: Magnetic Materials, Chapter 7: Ceramics and Glasses, Chapter 8: Solid State Theory, Simulations and Computation, Chapter 9: Carbon and Related Materials, Chapter 10: Semiconductors and Devices, Chapter 11: Metals and Alloys Keyword: Thin Film, superconductor, semiconductor, dielectric materials, magnetic materilas, ceramics, glasses. | ||
| 505 | 0 | |a Solid State Science and Technology IV; Short Description, Organizing Committee and Sponsors; Table of Contents; Chapter 1: Thin Film and Nanostructure; Structural and Optical Properties of Nickel-Doped Zinc Oxide Thin Film on Nickel Seed Layer Deposited by RF Magnetron Sputtering Technique; Properties of Calix4-Lead(Pb) Films Using Langmuir-Blodgett (LB) Technique as an Application of Ion Sensor; Effect of Substrate Temperature on Structural and Morphological Properties of Indium Tin Oxide Nanocolumns Using RF Magnetron Sputtering | |
| 505 | 8 | |a Effect of Thickness and Annealing Temperature on the Properties of PZT Films at Morphotropic Phase Boundary Composition Prepared by Sol-Gel Spin-On TechniquePreparation of Porous Alumina Template for Nanostructure Fabrication; Characterization of Al2O3 Thin Films Deposited by PLD; Characteristics of Cuprous Oxide Thin Films Deposited on Glass and Polyethylene Terephthalate Substrates; Crystallographic Parameter and Optical Absorption Measurement of CuInSe2 Thin Films for Solar Cells; Plasma Pre-Treatment of Polyethylene Terephthalate Substrate Influence on the Properties of ZnO Thin Film | |
| 546 | |a English. | ||
| 650 | 0 | |a Solid state physics |v Congresses. | |
| 650 | 6 | |a Physique de l'état solide |v Congrès. | |
| 650 | 7 | |a SCIENCE |x Energy. |2 bisacsh | |
| 650 | 7 | |a SCIENCE |x Mechanics |x General. |2 bisacsh | |
| 650 | 7 | |a SCIENCE |x Physics |x General. |2 bisacsh | |
| 650 | 7 | |a Solid state physics |2 fast | |
| 653 | 1 | |a Soild state science | |
| 653 | 1 | |a ICSSST | |
| 655 | 7 | |a Conference papers and proceedings |2 fast | |
| 700 | 1 | |a Huang, Nay Ming, |e editor. | |
| 700 | 1 | |a Rahman, Saadah Abd, |e editor. | |
| 700 | 1 | |a Lin, Woon Kai, |e editor. | |
| 758 | |i has work: |a Solid state science and technology IV (Text) |1 https://id.oclc.org/worldcat/entity/E39PCFvJW3FTgyRTqBgtvx7gDq |4 https://id.oclc.org/worldcat/ontology/hasWork | ||
| 776 | 0 | 8 | |i Print version: |a International Conference on Solid State Science and Technology (4th : 2012 : Melaka, Malaysia). |t Solid state science and technology IV : selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia. |d Zurich, Switzerland : TTP, ©2014 |h 590 pages |k Advanced materials research ; Volume 895 |x 1662-8985 |z 9783038350330 |
| 830 | 0 | |a Advanced materials research ; |v v. 895. |0 http://id.loc.gov/authorities/names/n99255722 | |
| 856 | 4 | 0 | |l FWS01 |p ZDB-4-EBA |q FWS_PDA_EBA |u https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711975 |3 Volltext |
| 938 | |a EBL - Ebook Library |b EBLB |n EBL1910730 | ||
| 938 | |a ebrary |b EBRY |n ebr10846246 | ||
| 938 | |a EBSCOhost |b EBSC |n 711975 | ||
| 938 | |a Trans Tech Publications, Ltd |b TRAN |n 10.4028/www.scientific.net/AMR.895 | ||
| 938 | |a YBP Library Services |b YANK |n 11697662 | ||
| 994 | |a 92 |b GEBAY | ||
| 912 | |a ZDB-4-EBA | ||
| 049 | |a DE-863 | ||
Datensatz im Suchindex
| DE-BY-FWS_katkey | ZDB-4-EBA-ocn878138257 |
|---|---|
| _version_ | 1816882269606903808 |
| adam_text | |
| any_adam_object | |
| author2 | Huang, Nay Ming Rahman, Saadah Abd Lin, Woon Kai |
| author2_role | edt edt edt |
| author2_variant | n m h nm nmh s a r sa sar w k l wk wkl |
| author_corporate | International Conference on Solid State Science and Technology Melaka, Malaysia |
| author_corporate_role | |
| author_facet | Huang, Nay Ming Rahman, Saadah Abd Lin, Woon Kai International Conference on Solid State Science and Technology Melaka, Malaysia |
| author_sort | International Conference on Solid State Science and Technology Melaka, Malaysia |
| building | Verbundindex |
| bvnumber | localFWS |
| callnumber-first | Q - Science |
| callnumber-label | QC176 |
| callnumber-raw | QC176.A1 .S655 2014eb |
| callnumber-search | QC176.A1 .S655 2014eb |
| callnumber-sort | QC 3176 A1 S655 42014EB |
| callnumber-subject | QC - Physics |
| collection | ZDB-4-EBA |
| contents | Solid State Science and Technology IV; Short Description, Organizing Committee and Sponsors; Table of Contents; Chapter 1: Thin Film and Nanostructure; Structural and Optical Properties of Nickel-Doped Zinc Oxide Thin Film on Nickel Seed Layer Deposited by RF Magnetron Sputtering Technique; Properties of Calix4-Lead(Pb) Films Using Langmuir-Blodgett (LB) Technique as an Application of Ion Sensor; Effect of Substrate Temperature on Structural and Morphological Properties of Indium Tin Oxide Nanocolumns Using RF Magnetron Sputtering Effect of Thickness and Annealing Temperature on the Properties of PZT Films at Morphotropic Phase Boundary Composition Prepared by Sol-Gel Spin-On TechniquePreparation of Porous Alumina Template for Nanostructure Fabrication; Characterization of Al2O3 Thin Films Deposited by PLD; Characteristics of Cuprous Oxide Thin Films Deposited on Glass and Polyethylene Terephthalate Substrates; Crystallographic Parameter and Optical Absorption Measurement of CuInSe2 Thin Films for Solar Cells; Plasma Pre-Treatment of Polyethylene Terephthalate Substrate Influence on the Properties of ZnO Thin Film |
| ctrlnum | (OCoLC)878138257 |
| dewey-full | 530.41 |
| dewey-hundreds | 500 - Natural sciences and mathematics |
| dewey-ones | 530 - Physics |
| dewey-raw | 530.41 |
| dewey-search | 530.41 |
| dewey-sort | 3530.41 |
| dewey-tens | 530 - Physics |
| discipline | Physik |
| format | Electronic Conference Proceeding eBook |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>05645cam a2200697 i 4500</leader><controlfield tag="001">ZDB-4-EBA-ocn878138257</controlfield><controlfield tag="003">OCoLC</controlfield><controlfield tag="005">20241004212047.0</controlfield><controlfield tag="006">m o d </controlfield><controlfield tag="007">cr cn|||||||||</controlfield><controlfield tag="008">140322t20142014sz ao ob 101 0 eng d</controlfield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">E7B</subfield><subfield code="b">eng</subfield><subfield code="e">rda</subfield><subfield code="e">pn</subfield><subfield code="c">E7B</subfield><subfield code="d">CUS</subfield><subfield code="d">OCLCO</subfield><subfield code="d">N$T</subfield><subfield code="d">OCLCO</subfield><subfield code="d">UKMGB</subfield><subfield code="d">OCLCF</subfield><subfield code="d">EBLCP</subfield><subfield code="d">YDXCP</subfield><subfield code="d">DEBSZ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCLCO</subfield><subfield code="d">LLB</subfield><subfield code="d">OCL</subfield><subfield code="d">DXU</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCL</subfield><subfield code="d">OCLCO</subfield><subfield code="d">AGLDB</subfield><subfield code="d">CCO</subfield><subfield code="d">PIFBY</subfield><subfield code="d">ZCU</subfield><subfield code="d">MERUC</subfield><subfield code="d">U3W</subfield><subfield code="d">STF</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">VTS</subfield><subfield code="d">ICG</subfield><subfield code="d">INT</subfield><subfield code="d">VT2</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">TKN</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">DKC</subfield><subfield code="d">AU@</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">M8D</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">OCL</subfield><subfield code="d">HS0</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">TTECH</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCQ</subfield><subfield code="d">QGK</subfield><subfield code="d">SFB</subfield><subfield code="d">OCLCO</subfield><subfield code="d">OCLCL</subfield></datafield><datafield tag="016" ind1="7" ind2=" "><subfield code="a">016788834</subfield><subfield code="2">Uk</subfield></datafield><datafield tag="019" ind1=" " ind2=" "><subfield code="a">927293181</subfield><subfield code="a">961584665</subfield><subfield code="a">962669729</subfield><subfield code="a">1259264188</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9783038264149</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">3038264148</subfield><subfield code="q">(electronic bk.)</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="z">9783038350330</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)878138257</subfield><subfield code="z">(OCoLC)927293181</subfield><subfield code="z">(OCoLC)961584665</subfield><subfield code="z">(OCoLC)962669729</subfield><subfield code="z">(OCoLC)1259264188</subfield></datafield><datafield tag="050" ind1=" " ind2="4"><subfield code="a">QC176.A1</subfield><subfield code="b">.S655 2014eb</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">SCI</subfield><subfield code="x">024000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">SCI</subfield><subfield code="x">041000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="072" ind1=" " ind2="7"><subfield code="a">SCI</subfield><subfield code="x">055000</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="082" ind1="7" ind2=" "><subfield code="a">530.41</subfield><subfield code="2">23</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">MAIN</subfield></datafield><datafield tag="111" ind1="2" ind2=" "><subfield code="a">International Conference on Solid State Science and Technology</subfield><subfield code="n">(4th :</subfield><subfield code="d">2012 :</subfield><subfield code="c">Melaka, Malaysia)</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Solid state science and technology IV :</subfield><subfield code="b">selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia /</subfield><subfield code="c">edited by Huang Nay Ming, Saadah Abd Rahman and Woon Kai Lin.</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">Zurich, Switzerland :</subfield><subfield code="b">Trans Tech Publications,</subfield><subfield code="c">[2014]</subfield></datafield><datafield tag="264" ind1=" " ind2="4"><subfield code="c">©2014</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">1 online resource (586 pages) :</subfield><subfield code="b">illustrations (some color), graphs, photographs</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="a">text</subfield><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="a">computer</subfield><subfield code="b">c</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="a">online resource</subfield><subfield code="b">cr</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="1" ind2=" "><subfield code="a">Advanced Materials Research,</subfield><subfield code="x">1662-8985 ;</subfield><subfield code="v">Vol. 895</subfield></datafield><datafield tag="504" ind1=" " ind2=" "><subfield code="a">Includes bibliographical references at the end of each chapters and indexes.</subfield></datafield><datafield tag="588" ind1="0" ind2=" "><subfield code="a">Online resource; title from PDF title page (ebrary, viewed March 20, 2014).</subfield></datafield><datafield tag="520" ind1=" " ind2=" "><subfield code="a">Collection of selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology, December 18-20, 2013, Melaka, Malaysia. The 105 papers are grouped as follows: Chapter 1: Thin Film and Nanostructure, Chapter 2: Superconductors, Chapter 3: Biomaterials Based Molecular Electronics, Chapter 4: Polymers and Composites, Chapter 5: Optical and Dielectric Materials, Chapter 6: Magnetic Materials, Chapter 7: Ceramics and Glasses, Chapter 8: Solid State Theory, Simulations and Computation, Chapter 9: Carbon and Related Materials, Chapter 10: Semiconductors and Devices, Chapter 11: Metals and Alloys Keyword: Thin Film, superconductor, semiconductor, dielectric materials, magnetic materilas, ceramics, glasses.</subfield></datafield><datafield tag="505" ind1="0" ind2=" "><subfield code="a">Solid State Science and Technology IV; Short Description, Organizing Committee and Sponsors; Table of Contents; Chapter 1: Thin Film and Nanostructure; Structural and Optical Properties of Nickel-Doped Zinc Oxide Thin Film on Nickel Seed Layer Deposited by RF Magnetron Sputtering Technique; Properties of Calix4-Lead(Pb) Films Using Langmuir-Blodgett (LB) Technique as an Application of Ion Sensor; Effect of Substrate Temperature on Structural and Morphological Properties of Indium Tin Oxide Nanocolumns Using RF Magnetron Sputtering</subfield></datafield><datafield tag="505" ind1="8" ind2=" "><subfield code="a">Effect of Thickness and Annealing Temperature on the Properties of PZT Films at Morphotropic Phase Boundary Composition Prepared by Sol-Gel Spin-On TechniquePreparation of Porous Alumina Template for Nanostructure Fabrication; Characterization of Al2O3 Thin Films Deposited by PLD; Characteristics of Cuprous Oxide Thin Films Deposited on Glass and Polyethylene Terephthalate Substrates; Crystallographic Parameter and Optical Absorption Measurement of CuInSe2 Thin Films for Solar Cells; Plasma Pre-Treatment of Polyethylene Terephthalate Substrate Influence on the Properties of ZnO Thin Film</subfield></datafield><datafield tag="546" ind1=" " ind2=" "><subfield code="a">English.</subfield></datafield><datafield tag="650" ind1=" " ind2="0"><subfield code="a">Solid state physics</subfield><subfield code="v">Congresses.</subfield></datafield><datafield tag="650" ind1=" " ind2="6"><subfield code="a">Physique de l'état solide</subfield><subfield code="v">Congrès.</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">SCIENCE</subfield><subfield code="x">Energy.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">SCIENCE</subfield><subfield code="x">Mechanics</subfield><subfield code="x">General.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">SCIENCE</subfield><subfield code="x">Physics</subfield><subfield code="x">General.</subfield><subfield code="2">bisacsh</subfield></datafield><datafield tag="650" ind1=" " ind2="7"><subfield code="a">Solid state physics</subfield><subfield code="2">fast</subfield></datafield><datafield tag="653" ind1="1" ind2=" "><subfield code="a">Soild state science</subfield></datafield><datafield tag="653" ind1="1" ind2=" "><subfield code="a">ICSSST</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="a">Conference papers and proceedings</subfield><subfield code="2">fast</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Huang, Nay Ming,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Rahman, Saadah Abd,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Lin, Woon Kai,</subfield><subfield code="e">editor.</subfield></datafield><datafield tag="758" ind1=" " ind2=" "><subfield code="i">has work:</subfield><subfield code="a">Solid state science and technology IV (Text)</subfield><subfield code="1">https://id.oclc.org/worldcat/entity/E39PCFvJW3FTgyRTqBgtvx7gDq</subfield><subfield code="4">https://id.oclc.org/worldcat/ontology/hasWork</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Print version:</subfield><subfield code="a">International Conference on Solid State Science and Technology (4th : 2012 : Melaka, Malaysia).</subfield><subfield code="t">Solid state science and technology IV : selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia.</subfield><subfield code="d">Zurich, Switzerland : TTP, ©2014</subfield><subfield code="h">590 pages</subfield><subfield code="k">Advanced materials research ; Volume 895</subfield><subfield code="x">1662-8985</subfield><subfield code="z">9783038350330</subfield></datafield><datafield tag="830" ind1=" " ind2="0"><subfield code="a">Advanced materials research ;</subfield><subfield code="v">v. 895.</subfield><subfield code="0">http://id.loc.gov/authorities/names/n99255722</subfield></datafield><datafield tag="856" ind1="4" ind2="0"><subfield code="l">FWS01</subfield><subfield code="p">ZDB-4-EBA</subfield><subfield code="q">FWS_PDA_EBA</subfield><subfield code="u">https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711975</subfield><subfield code="3">Volltext</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBL - Ebook Library</subfield><subfield code="b">EBLB</subfield><subfield code="n">EBL1910730</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">ebrary</subfield><subfield code="b">EBRY</subfield><subfield code="n">ebr10846246</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">EBSCOhost</subfield><subfield code="b">EBSC</subfield><subfield code="n">711975</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">Trans Tech Publications, Ltd</subfield><subfield code="b">TRAN</subfield><subfield code="n">10.4028/www.scientific.net/AMR.895</subfield></datafield><datafield tag="938" ind1=" " ind2=" "><subfield code="a">YBP Library Services</subfield><subfield code="b">YANK</subfield><subfield code="n">11697662</subfield></datafield><datafield tag="994" ind1=" " ind2=" "><subfield code="a">92</subfield><subfield code="b">GEBAY</subfield></datafield><datafield tag="912" ind1=" " ind2=" "><subfield code="a">ZDB-4-EBA</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-863</subfield></datafield></record></collection> |
| genre | Conference papers and proceedings fast |
| genre_facet | Conference papers and proceedings |
| id | ZDB-4-EBA-ocn878138257 |
| illustrated | Illustrated |
| indexdate | 2024-11-27T13:25:56Z |
| institution | BVB |
| isbn | 9783038264149 3038264148 |
| issn | 1662-8985 ; 1662-8985 |
| language | English |
| oclc_num | 878138257 |
| open_access_boolean | |
| owner | MAIN DE-863 DE-BY-FWS |
| owner_facet | MAIN DE-863 DE-BY-FWS |
| physical | 1 online resource (586 pages) : illustrations (some color), graphs, photographs |
| psigel | ZDB-4-EBA |
| publishDate | 2014 |
| publishDateSearch | 2014 |
| publishDateSort | 2014 |
| publisher | Trans Tech Publications, |
| record_format | marc |
| series | Advanced materials research ; |
| series2 | Advanced Materials Research, |
| spelling | International Conference on Solid State Science and Technology (4th : 2012 : Melaka, Malaysia) Solid state science and technology IV : selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia / edited by Huang Nay Ming, Saadah Abd Rahman and Woon Kai Lin. Zurich, Switzerland : Trans Tech Publications, [2014] ©2014 1 online resource (586 pages) : illustrations (some color), graphs, photographs text txt rdacontent computer c rdamedia online resource cr rdacarrier Advanced Materials Research, 1662-8985 ; Vol. 895 Includes bibliographical references at the end of each chapters and indexes. Online resource; title from PDF title page (ebrary, viewed March 20, 2014). Collection of selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology, December 18-20, 2013, Melaka, Malaysia. The 105 papers are grouped as follows: Chapter 1: Thin Film and Nanostructure, Chapter 2: Superconductors, Chapter 3: Biomaterials Based Molecular Electronics, Chapter 4: Polymers and Composites, Chapter 5: Optical and Dielectric Materials, Chapter 6: Magnetic Materials, Chapter 7: Ceramics and Glasses, Chapter 8: Solid State Theory, Simulations and Computation, Chapter 9: Carbon and Related Materials, Chapter 10: Semiconductors and Devices, Chapter 11: Metals and Alloys Keyword: Thin Film, superconductor, semiconductor, dielectric materials, magnetic materilas, ceramics, glasses. Solid State Science and Technology IV; Short Description, Organizing Committee and Sponsors; Table of Contents; Chapter 1: Thin Film and Nanostructure; Structural and Optical Properties of Nickel-Doped Zinc Oxide Thin Film on Nickel Seed Layer Deposited by RF Magnetron Sputtering Technique; Properties of Calix4-Lead(Pb) Films Using Langmuir-Blodgett (LB) Technique as an Application of Ion Sensor; Effect of Substrate Temperature on Structural and Morphological Properties of Indium Tin Oxide Nanocolumns Using RF Magnetron Sputtering Effect of Thickness and Annealing Temperature on the Properties of PZT Films at Morphotropic Phase Boundary Composition Prepared by Sol-Gel Spin-On TechniquePreparation of Porous Alumina Template for Nanostructure Fabrication; Characterization of Al2O3 Thin Films Deposited by PLD; Characteristics of Cuprous Oxide Thin Films Deposited on Glass and Polyethylene Terephthalate Substrates; Crystallographic Parameter and Optical Absorption Measurement of CuInSe2 Thin Films for Solar Cells; Plasma Pre-Treatment of Polyethylene Terephthalate Substrate Influence on the Properties of ZnO Thin Film English. Solid state physics Congresses. Physique de l'état solide Congrès. SCIENCE Energy. bisacsh SCIENCE Mechanics General. bisacsh SCIENCE Physics General. bisacsh Solid state physics fast Soild state science ICSSST Conference papers and proceedings fast Huang, Nay Ming, editor. Rahman, Saadah Abd, editor. Lin, Woon Kai, editor. has work: Solid state science and technology IV (Text) https://id.oclc.org/worldcat/entity/E39PCFvJW3FTgyRTqBgtvx7gDq https://id.oclc.org/worldcat/ontology/hasWork Print version: International Conference on Solid State Science and Technology (4th : 2012 : Melaka, Malaysia). Solid state science and technology IV : selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia. Zurich, Switzerland : TTP, ©2014 590 pages Advanced materials research ; Volume 895 1662-8985 9783038350330 Advanced materials research ; v. 895. http://id.loc.gov/authorities/names/n99255722 FWS01 ZDB-4-EBA FWS_PDA_EBA https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711975 Volltext |
| spellingShingle | Solid state science and technology IV : selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia / Advanced materials research ; Solid State Science and Technology IV; Short Description, Organizing Committee and Sponsors; Table of Contents; Chapter 1: Thin Film and Nanostructure; Structural and Optical Properties of Nickel-Doped Zinc Oxide Thin Film on Nickel Seed Layer Deposited by RF Magnetron Sputtering Technique; Properties of Calix4-Lead(Pb) Films Using Langmuir-Blodgett (LB) Technique as an Application of Ion Sensor; Effect of Substrate Temperature on Structural and Morphological Properties of Indium Tin Oxide Nanocolumns Using RF Magnetron Sputtering Effect of Thickness and Annealing Temperature on the Properties of PZT Films at Morphotropic Phase Boundary Composition Prepared by Sol-Gel Spin-On TechniquePreparation of Porous Alumina Template for Nanostructure Fabrication; Characterization of Al2O3 Thin Films Deposited by PLD; Characteristics of Cuprous Oxide Thin Films Deposited on Glass and Polyethylene Terephthalate Substrates; Crystallographic Parameter and Optical Absorption Measurement of CuInSe2 Thin Films for Solar Cells; Plasma Pre-Treatment of Polyethylene Terephthalate Substrate Influence on the Properties of ZnO Thin Film Solid state physics Congresses. Physique de l'état solide Congrès. SCIENCE Energy. bisacsh SCIENCE Mechanics General. bisacsh SCIENCE Physics General. bisacsh Solid state physics fast |
| title | Solid state science and technology IV : selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia / |
| title_auth | Solid state science and technology IV : selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia / |
| title_exact_search | Solid state science and technology IV : selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia / |
| title_full | Solid state science and technology IV : selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia / edited by Huang Nay Ming, Saadah Abd Rahman and Woon Kai Lin. |
| title_fullStr | Solid state science and technology IV : selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia / edited by Huang Nay Ming, Saadah Abd Rahman and Woon Kai Lin. |
| title_full_unstemmed | Solid state science and technology IV : selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia / edited by Huang Nay Ming, Saadah Abd Rahman and Woon Kai Lin. |
| title_short | Solid state science and technology IV : |
| title_sort | solid state science and technology iv selected peer reviewed papers from the 4th international conference on solid state science and technology icssst 2012 december 18 20 2012 melaka malaysia |
| title_sub | selected, peer reviewed papers from the 4th International Conference on Solid State Science and Technology (ICSSST 2012), December 18-20, 2012, Melaka, Malaysia / |
| topic | Solid state physics Congresses. Physique de l'état solide Congrès. SCIENCE Energy. bisacsh SCIENCE Mechanics General. bisacsh SCIENCE Physics General. bisacsh Solid state physics fast |
| topic_facet | Solid state physics Congresses. Physique de l'état solide Congrès. SCIENCE Energy. SCIENCE Mechanics General. SCIENCE Physics General. Solid state physics Conference papers and proceedings |
| url | https://search.ebscohost.com/login.aspx?direct=true&scope=site&db=nlebk&AN=711975 |
| work_keys_str_mv | AT internationalconferenceonsolidstatescienceandtechnologymelakamalaysia solidstatescienceandtechnologyivselectedpeerreviewedpapersfromthe4thinternationalconferenceonsolidstatescienceandtechnologyicssst2012december18202012melakamalaysia AT huangnayming solidstatescienceandtechnologyivselectedpeerreviewedpapersfromthe4thinternationalconferenceonsolidstatescienceandtechnologyicssst2012december18202012melakamalaysia AT rahmansaadahabd solidstatescienceandtechnologyivselectedpeerreviewedpapersfromthe4thinternationalconferenceonsolidstatescienceandtechnologyicssst2012december18202012melakamalaysia AT linwoonkai solidstatescienceandtechnologyivselectedpeerreviewedpapersfromthe4thinternationalconferenceonsolidstatescienceandtechnologyicssst2012december18202012melakamalaysia |