Ethical and aesthetic explorations of systemic practice: new critical reflections
"In Ethical and Aesthetic Explorations of Systemic Practice, the four co-authors come together to rhizomatically consider how systemic theories can be reinvigorated in the present day. This fascinating book uses the ideas and work of renowned anthropologist Gregory Bateson as a springboard from...
Gespeichert in:
| Hauptverfasser: | , , , |
|---|---|
| Format: | Buch |
| Sprache: | English |
| Veröffentlicht: |
London ; New York, NY
Routledge
2022
|
| Schriftenreihe: | The> systemic thinking and practice series
|
| Schlagworte: | |
| Online-Zugang: | Inhaltsverzeichnis |
| Zusammenfassung: | "In Ethical and Aesthetic Explorations of Systemic Practice, the four co-authors come together to rhizomatically consider how systemic theories can be reinvigorated in the present day. This fascinating book uses the ideas and work of renowned anthropologist Gregory Bateson as a springboard from which to examine the fundamental tenets of systemic theory and practice, as well as looking to the work of Deleuze, Guattari, Maturana, Varela and von Foerster. Including contributions from a range of renowned therapists, each chapter examines the guiding principles from a critical perspective, asking questions around the ontology of the therapeutic encounter and the technique of therapy itself. This revivifying volume will be of interest to systemic professionals, and those looking at how the systemic community can continue to grow and evolve"-- |
| Beschreibung: | x, 162 Seiten 25 cm |
| ISBN: | 9781138346192 9781138346215 |
Internformat
MARC
| LEADER | 00000nam a2200000 c 4500 | ||
|---|---|---|---|
| 001 | BV048556918 | ||
| 003 | DE-604 | ||
| 005 | 20230111 | ||
| 007 | t | ||
| 008 | 221111s2022 b||| 00||| eng d | ||
| 020 | |a 9781138346192 |c hardback |9 978-1-138-34619-2 | ||
| 020 | |a 9781138346215 |c paperback |9 978-1-138-34621-5 | ||
| 035 | |a (OCoLC)1356730920 | ||
| 035 | |a (DE-599)BVBBV048556918 | ||
| 040 | |a DE-604 |b ger |e rda | ||
| 041 | 0 | |a eng | |
| 049 | |a DE-12 | ||
| 100 | 1 | |a Barbetta, Pietro |d 1954- |e Verfasser |0 (DE-588)127701129X |4 aut | |
| 245 | 1 | 0 | |a Ethical and aesthetic explorations of systemic practice |b new critical reflections |c Pietro Barbetta, Maria Esther Cavagnis, Inga-Britt Krause and Umberta Telfener |
| 264 | 1 | |a London ; New York, NY |b Routledge |c 2022 | |
| 300 | |a x, 162 Seiten |c 25 cm | ||
| 336 | |b txt |2 rdacontent | ||
| 337 | |b n |2 rdamedia | ||
| 338 | |b nc |2 rdacarrier | ||
| 490 | 0 | |a The> systemic thinking and practice series | |
| 520 | 3 | |a "In Ethical and Aesthetic Explorations of Systemic Practice, the four co-authors come together to rhizomatically consider how systemic theories can be reinvigorated in the present day. This fascinating book uses the ideas and work of renowned anthropologist Gregory Bateson as a springboard from which to examine the fundamental tenets of systemic theory and practice, as well as looking to the work of Deleuze, Guattari, Maturana, Varela and von Foerster. Including contributions from a range of renowned therapists, each chapter examines the guiding principles from a critical perspective, asking questions around the ontology of the therapeutic encounter and the technique of therapy itself. This revivifying volume will be of interest to systemic professionals, and those looking at how the systemic community can continue to grow and evolve"-- | |
| 650 | 0 | 7 | |a Systemtheorie |0 (DE-588)4058812-9 |2 gnd |9 rswk-swf |
| 650 | 0 | 7 | |a Familientherapie |0 (DE-588)4016421-4 |2 gnd |9 rswk-swf |
| 653 | 0 | |a Systemic therapy (Family therapy) | |
| 653 | 0 | |a Thérapie familiale systémique | |
| 653 | 0 | |a Systemic therapy (Family therapy) | |
| 655 | 7 | |0 (DE-588)4143413-4 |a Aufsatzsammlung |2 gnd-content | |
| 689 | 0 | 0 | |a Systemtheorie |0 (DE-588)4058812-9 |D s |
| 689 | 0 | 1 | |a Familientherapie |0 (DE-588)4016421-4 |D s |
| 689 | 0 | |5 DE-604 | |
| 700 | 1 | |a Cavagnis, Maria Esther |e Verfasser |0 (DE-588)1277011346 |4 aut | |
| 700 | 1 | |a Krause, Inga-Britt |e Verfasser |0 (DE-588)1277011419 |4 aut | |
| 700 | 1 | |a Telfener, Umberta |d 1951- |e Verfasser |0 (DE-588)138757992 |4 aut | |
| 776 | 0 | 8 | |i Erscheint auch als |n Online-Ausgabe |z 978-0-429-43741-0 |
| 856 | 4 | 2 | |m Digitalisierung BSB München - ADAM Catalogue Enrichment |q application/pdf |u http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=033933184&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |3 Inhaltsverzeichnis |
| 999 | |a oai:aleph.bib-bvb.de:BVB01-033933184 | ||
Datensatz im Suchindex
| _version_ | 1804184567831068672 |
|---|---|
| adam_text | Contents ix Series Editors’ Foreword CHARLOTTE BURCK AND GWYN DANIEL 1 Introduction: Why Ethic and Aesthetic in Systemic Practices 1 PIETRO BARBETTA, MARIA ESTHER CAVAGNIS, INGA-BRITT KRAUSE AND UMBERTA TELFENER 2 Two Regimes of Madness in Psychotherapy 16 PIETRO BARBETTA 3 Revolutionary Childhood 38 MARIA ESTHER CAVAGNIS 4 Thoughts from the Outside 54 INGA-BRITT KRAUSE 5 Getting Sick from Psychotherapy: Our Co-Responsibility in Unintended and Undesired Outcomes 75 UMBERTA TELFENER 6 Aesthetics, Ethics and Politics in Childhood Matters 96 MARIA ESTHER CAVAGNIS AND INGA-BRITT KRAUSE 7 Clinical Practice as Ecological Aesthetics 127 PIETRO BARBETTA, MARIA ESTHER CAVAGNIS, INGA-BRITT KRAUSE AND UMBERTA TELFENER 8 Babel, Bebel and Other Dangerous Glossolalia PIETRO BARBETTA, MARIA ESTHER CAVAGNIS, INGA-BRITT KRAUSE AND UMBERTA TELFENER 141
viii Contents Postscript: The Event 155 (•» TRO BARBETTA, MARIA ESTHER CAVAGNIS. INGA-BRITT KRAUSE AND l MB! RI A TELI ENER Index 159
|
| adam_txt |
Contents ix Series Editors’ Foreword CHARLOTTE BURCK AND GWYN DANIEL 1 Introduction: Why Ethic and Aesthetic in Systemic Practices 1 PIETRO BARBETTA, MARIA ESTHER CAVAGNIS, INGA-BRITT KRAUSE AND UMBERTA TELFENER 2 Two Regimes of Madness in Psychotherapy 16 PIETRO BARBETTA 3 Revolutionary Childhood 38 MARIA ESTHER CAVAGNIS 4 Thoughts from the Outside 54 INGA-BRITT KRAUSE 5 Getting Sick from Psychotherapy: Our Co-Responsibility in Unintended and Undesired Outcomes 75 UMBERTA TELFENER 6 Aesthetics, Ethics and Politics in Childhood Matters 96 MARIA ESTHER CAVAGNIS AND INGA-BRITT KRAUSE 7 Clinical Practice as Ecological Aesthetics 127 PIETRO BARBETTA, MARIA ESTHER CAVAGNIS, INGA-BRITT KRAUSE AND UMBERTA TELFENER 8 Babel, Bebel and Other Dangerous Glossolalia PIETRO BARBETTA, MARIA ESTHER CAVAGNIS, INGA-BRITT KRAUSE AND UMBERTA TELFENER 141
viii Contents Postscript: The Event 155 (•» TRO BARBETTA, MARIA ESTHER CAVAGNIS. INGA-BRITT KRAUSE AND l MB! RI A TELI ENER Index 159 |
| any_adam_object | 1 |
| any_adam_object_boolean | 1 |
| author | Barbetta, Pietro 1954- Cavagnis, Maria Esther Krause, Inga-Britt Telfener, Umberta 1951- |
| author_GND | (DE-588)127701129X (DE-588)1277011346 (DE-588)1277011419 (DE-588)138757992 |
| author_facet | Barbetta, Pietro 1954- Cavagnis, Maria Esther Krause, Inga-Britt Telfener, Umberta 1951- |
| author_role | aut aut aut aut |
| author_sort | Barbetta, Pietro 1954- |
| author_variant | p b pb m e c me mec i b k ibk u t ut |
| building | Verbundindex |
| bvnumber | BV048556918 |
| ctrlnum | (OCoLC)1356730920 (DE-599)BVBBV048556918 |
| format | Book |
| fullrecord | <?xml version="1.0" encoding="UTF-8"?><collection xmlns="http://www.loc.gov/MARC21/slim"><record><leader>02896nam a2200457 c 4500</leader><controlfield tag="001">BV048556918</controlfield><controlfield tag="003">DE-604</controlfield><controlfield tag="005">20230111 </controlfield><controlfield tag="007">t</controlfield><controlfield tag="008">221111s2022 b||| 00||| eng d</controlfield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781138346192</subfield><subfield code="c">hardback</subfield><subfield code="9">978-1-138-34619-2</subfield></datafield><datafield tag="020" ind1=" " ind2=" "><subfield code="a">9781138346215</subfield><subfield code="c">paperback</subfield><subfield code="9">978-1-138-34621-5</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(OCoLC)1356730920</subfield></datafield><datafield tag="035" ind1=" " ind2=" "><subfield code="a">(DE-599)BVBBV048556918</subfield></datafield><datafield tag="040" ind1=" " ind2=" "><subfield code="a">DE-604</subfield><subfield code="b">ger</subfield><subfield code="e">rda</subfield></datafield><datafield tag="041" ind1="0" ind2=" "><subfield code="a">eng</subfield></datafield><datafield tag="049" ind1=" " ind2=" "><subfield code="a">DE-12</subfield></datafield><datafield tag="100" ind1="1" ind2=" "><subfield code="a">Barbetta, Pietro</subfield><subfield code="d">1954-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)127701129X</subfield><subfield code="4">aut</subfield></datafield><datafield tag="245" ind1="1" ind2="0"><subfield code="a">Ethical and aesthetic explorations of systemic practice</subfield><subfield code="b">new critical reflections</subfield><subfield code="c">Pietro Barbetta, Maria Esther Cavagnis, Inga-Britt Krause and Umberta Telfener</subfield></datafield><datafield tag="264" ind1=" " ind2="1"><subfield code="a">London ; New York, NY</subfield><subfield code="b">Routledge</subfield><subfield code="c">2022</subfield></datafield><datafield tag="300" ind1=" " ind2=" "><subfield code="a">x, 162 Seiten</subfield><subfield code="c">25 cm</subfield></datafield><datafield tag="336" ind1=" " ind2=" "><subfield code="b">txt</subfield><subfield code="2">rdacontent</subfield></datafield><datafield tag="337" ind1=" " ind2=" "><subfield code="b">n</subfield><subfield code="2">rdamedia</subfield></datafield><datafield tag="338" ind1=" " ind2=" "><subfield code="b">nc</subfield><subfield code="2">rdacarrier</subfield></datafield><datafield tag="490" ind1="0" ind2=" "><subfield code="a">The> systemic thinking and practice series</subfield></datafield><datafield tag="520" ind1="3" ind2=" "><subfield code="a">"In Ethical and Aesthetic Explorations of Systemic Practice, the four co-authors come together to rhizomatically consider how systemic theories can be reinvigorated in the present day. This fascinating book uses the ideas and work of renowned anthropologist Gregory Bateson as a springboard from which to examine the fundamental tenets of systemic theory and practice, as well as looking to the work of Deleuze, Guattari, Maturana, Varela and von Foerster. Including contributions from a range of renowned therapists, each chapter examines the guiding principles from a critical perspective, asking questions around the ontology of the therapeutic encounter and the technique of therapy itself. This revivifying volume will be of interest to systemic professionals, and those looking at how the systemic community can continue to grow and evolve"--</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Systemtheorie</subfield><subfield code="0">(DE-588)4058812-9</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="650" ind1="0" ind2="7"><subfield code="a">Familientherapie</subfield><subfield code="0">(DE-588)4016421-4</subfield><subfield code="2">gnd</subfield><subfield code="9">rswk-swf</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Systemic therapy (Family therapy)</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Thérapie familiale systémique</subfield></datafield><datafield tag="653" ind1=" " ind2="0"><subfield code="a">Systemic therapy (Family therapy)</subfield></datafield><datafield tag="655" ind1=" " ind2="7"><subfield code="0">(DE-588)4143413-4</subfield><subfield code="a">Aufsatzsammlung</subfield><subfield code="2">gnd-content</subfield></datafield><datafield tag="689" ind1="0" ind2="0"><subfield code="a">Systemtheorie</subfield><subfield code="0">(DE-588)4058812-9</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2="1"><subfield code="a">Familientherapie</subfield><subfield code="0">(DE-588)4016421-4</subfield><subfield code="D">s</subfield></datafield><datafield tag="689" ind1="0" ind2=" "><subfield code="5">DE-604</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Cavagnis, Maria Esther</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1277011346</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Krause, Inga-Britt</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)1277011419</subfield><subfield code="4">aut</subfield></datafield><datafield tag="700" ind1="1" ind2=" "><subfield code="a">Telfener, Umberta</subfield><subfield code="d">1951-</subfield><subfield code="e">Verfasser</subfield><subfield code="0">(DE-588)138757992</subfield><subfield code="4">aut</subfield></datafield><datafield tag="776" ind1="0" ind2="8"><subfield code="i">Erscheint auch als</subfield><subfield code="n">Online-Ausgabe</subfield><subfield code="z">978-0-429-43741-0</subfield></datafield><datafield tag="856" ind1="4" ind2="2"><subfield code="m">Digitalisierung BSB München - ADAM Catalogue Enrichment</subfield><subfield code="q">application/pdf</subfield><subfield code="u">http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=033933184&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA</subfield><subfield code="3">Inhaltsverzeichnis</subfield></datafield><datafield tag="999" ind1=" " ind2=" "><subfield code="a">oai:aleph.bib-bvb.de:BVB01-033933184</subfield></datafield></record></collection> |
| genre | (DE-588)4143413-4 Aufsatzsammlung gnd-content |
| genre_facet | Aufsatzsammlung |
| id | DE-604.BV048556918 |
| illustrated | Not Illustrated |
| index_date | 2024-07-03T20:58:51Z |
| indexdate | 2024-07-10T09:41:24Z |
| institution | BVB |
| isbn | 9781138346192 9781138346215 |
| language | English |
| oai_aleph_id | oai:aleph.bib-bvb.de:BVB01-033933184 |
| oclc_num | 1356730920 |
| open_access_boolean | |
| owner | DE-12 |
| owner_facet | DE-12 |
| physical | x, 162 Seiten 25 cm |
| publishDate | 2022 |
| publishDateSearch | 2022 |
| publishDateSort | 2022 |
| publisher | Routledge |
| record_format | marc |
| series2 | The> systemic thinking and practice series |
| spelling | Barbetta, Pietro 1954- Verfasser (DE-588)127701129X aut Ethical and aesthetic explorations of systemic practice new critical reflections Pietro Barbetta, Maria Esther Cavagnis, Inga-Britt Krause and Umberta Telfener London ; New York, NY Routledge 2022 x, 162 Seiten 25 cm txt rdacontent n rdamedia nc rdacarrier The> systemic thinking and practice series "In Ethical and Aesthetic Explorations of Systemic Practice, the four co-authors come together to rhizomatically consider how systemic theories can be reinvigorated in the present day. This fascinating book uses the ideas and work of renowned anthropologist Gregory Bateson as a springboard from which to examine the fundamental tenets of systemic theory and practice, as well as looking to the work of Deleuze, Guattari, Maturana, Varela and von Foerster. Including contributions from a range of renowned therapists, each chapter examines the guiding principles from a critical perspective, asking questions around the ontology of the therapeutic encounter and the technique of therapy itself. This revivifying volume will be of interest to systemic professionals, and those looking at how the systemic community can continue to grow and evolve"-- Systemtheorie (DE-588)4058812-9 gnd rswk-swf Familientherapie (DE-588)4016421-4 gnd rswk-swf Systemic therapy (Family therapy) Thérapie familiale systémique (DE-588)4143413-4 Aufsatzsammlung gnd-content Systemtheorie (DE-588)4058812-9 s Familientherapie (DE-588)4016421-4 s DE-604 Cavagnis, Maria Esther Verfasser (DE-588)1277011346 aut Krause, Inga-Britt Verfasser (DE-588)1277011419 aut Telfener, Umberta 1951- Verfasser (DE-588)138757992 aut Erscheint auch als Online-Ausgabe 978-0-429-43741-0 Digitalisierung BSB München - ADAM Catalogue Enrichment application/pdf http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=033933184&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA Inhaltsverzeichnis |
| spellingShingle | Barbetta, Pietro 1954- Cavagnis, Maria Esther Krause, Inga-Britt Telfener, Umberta 1951- Ethical and aesthetic explorations of systemic practice new critical reflections Systemtheorie (DE-588)4058812-9 gnd Familientherapie (DE-588)4016421-4 gnd |
| subject_GND | (DE-588)4058812-9 (DE-588)4016421-4 (DE-588)4143413-4 |
| title | Ethical and aesthetic explorations of systemic practice new critical reflections |
| title_auth | Ethical and aesthetic explorations of systemic practice new critical reflections |
| title_exact_search | Ethical and aesthetic explorations of systemic practice new critical reflections |
| title_exact_search_txtP | Ethical and aesthetic explorations of systemic practice new critical reflections |
| title_full | Ethical and aesthetic explorations of systemic practice new critical reflections Pietro Barbetta, Maria Esther Cavagnis, Inga-Britt Krause and Umberta Telfener |
| title_fullStr | Ethical and aesthetic explorations of systemic practice new critical reflections Pietro Barbetta, Maria Esther Cavagnis, Inga-Britt Krause and Umberta Telfener |
| title_full_unstemmed | Ethical and aesthetic explorations of systemic practice new critical reflections Pietro Barbetta, Maria Esther Cavagnis, Inga-Britt Krause and Umberta Telfener |
| title_short | Ethical and aesthetic explorations of systemic practice |
| title_sort | ethical and aesthetic explorations of systemic practice new critical reflections |
| title_sub | new critical reflections |
| topic | Systemtheorie (DE-588)4058812-9 gnd Familientherapie (DE-588)4016421-4 gnd |
| topic_facet | Systemtheorie Familientherapie Aufsatzsammlung |
| url | http://bvbr.bib-bvb.de:8991/F?func=service&doc_library=BVB01&local_base=BVB01&doc_number=033933184&sequence=000001&line_number=0001&func_code=DB_RECORDS&service_type=MEDIA |
| work_keys_str_mv | AT barbettapietro ethicalandaestheticexplorationsofsystemicpracticenewcriticalreflections AT cavagnismariaesther ethicalandaestheticexplorationsofsystemicpracticenewcriticalreflections AT krauseingabritt ethicalandaestheticexplorationsofsystemicpracticenewcriticalreflections AT telfenerumberta ethicalandaestheticexplorationsofsystemicpracticenewcriticalreflections |